KEGG   Esox lucius (northern pike): 105011659Help
Entry
105011659         CDS       T04894                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
els  Esox lucius (northern pike)
Brite
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     105011659 (tmprss9)
Peptidases [BR:els01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105011659 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Ldl_recept_a DUF1986 SEA
Motif
Other DBs
NCBI-GeneID: 105011659
NCBI-ProteinID: XP_019904456
LinkDB All DBs
AA seq 784 aa AA seqDB search
MEVKKDCEWSPGERPATPPNSVCCRSILLAVILIFIGVFVGLLVAYLVQEKHYFIETVEL
TGLKYGPDLLDESSAFSIVLTFTLKSKIKNVFIASSIARHYIDCNIVAYGNIKGDVMATF
QLVFSVSKAQQYSDNFIQDLIRVGLNSLLHGKPIKVPAYGEINAIVLLGASGKSFYKIGN
DIAICPENTFTCDNSECVTKANAECDFIPDCADGSDEAYCSCGTRPAMGNRIVGGVEARP
GELPWQVSLRLHGRHTCGASIVNRQWLVTAAHCFEKDKNPQEWTALVGAHLVSGEERGAV
SVNVKSVVVSPDYNPSTTDNDVTVLELETALTFGPYIQPVCLPSSSHVFSPGRNCVVSGW
GALGQHSLSTPPTLQKAVVNIIDSKVCNKSSVYRGTLTENMMCAGFLQGKVDSCQGDSGG
PLVCEEAPGRFFLAGVVSWGIGCAQINKPGVYSRVTRLRNWILSHTNPGRLHSPVHSMPM
VPVPTATVSPISKIMAAAPLMPDVNCTENFQCRAGECISKINPECDSVTDCINEADEKNC
DCGMRPGVGTQRIVGGVTARRGEWPWLGSLQYQRSHRCGATLVHSKWLLTAAHCFKSDSG
PGSWSVSLGSVLRSGVGALVIPIQRIIMHPGFNSTNMNNDVALLELAVPAPRSYTIQAVC
LPSPVHRFHRDNECYITGWGSTREGGSLTNLLQKAPVNIIEQSDCLQAYGNGLTPGMMCA
GYMEGGKDTCLGDSGGPLTCREPSGQWFVAGVTSWGHGCGRSGFPGVYIQVTAIREWISD
YLPF
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggaggtaaagaaagattgtgagtggtccccaggggaacgccctgctactccccccaac
tctgtctgctgtaggagcatcctcttggctgttatcctcatcttcattggagtatttgtg
ggcttgttggttgcatacttggtgcaagagaagcattacttcattgagacagtggagctg
acaggtctcaagtatggccctgacctgctcgatgagagctctgcattctctatagttctg
acttttactctaaagtctaagatcaagaatgttttcattgcctcttcaatagcacgtcac
tatattgactgtaacattgttgcctatggtaacatcaaaggggatgtcatggccactttt
caattggtcttcagtgtgtctaaggcccagcagtactctgataactttattcaggatctc
ataagggtagggctgaattccctgcttcatgggaaacccataaaagtgccggcgtatgga
gagatcaacgcaattgtcttactgggggccagcggaaagtcattctataaaattggaaac
gatatagcaatctgccctgaaaacactttcacctgtgacaatagtgagtgtgtcaccaag
gccaacgcagagtgtgacttcatcccagactgtgccgatggctctgacgaggcttactgc
tcctgcggtactcgcccagccatgggcaacaggatagtgggcggagtagaagcccggcct
ggggagctgccctggcaggtcagtctgaggttgcacggcagacacacctgtggagcctcc
atcgtcaaccgccagtggctggtcactgccgctcactgctttgaaaaggacaagaacccg
caagaatggaccgccctggtcggagcccacctggtgagtggtgaagagcggggagccgtc
tctgtgaacgtcaagtctgtggtggtctctccagattataacccttcgaccacagacaac
gacgtgaccgtgctggagctagagactgccctcaccttcggcccctacatccagccggtc
tgtcttccctcctcctcccatgtcttcagccctgggaggaactgcgtggtgtcaggctgg
ggtgctctcggacagcactcacttagtaccccaccaactctgcagaaggcagtggtgaat
ataattgattcaaaggtctgcaacaagtcatccgtttacagaggcaccttgaccgaaaac
atgatgtgtgctggcttccttcaggggaaagtcgactcttgccagggtgactctggaggg
ccactggtgtgcgaggaggccccagggcggttcttcctggctggggtggtgagctggggc
attggctgtgctcagatcaacaagccaggggtctattcccgtgtcaccagattacggaac
tggatcctcagccacaccaaccctggcaggctccactccccggtccactccatgccaatg
gtgccggttcccacagcaacagtcagtcctatttccaagataatggcagcggcgccactc
atgcctgatgtgaactgtactgagaacttccagtgcagagctggggagtgtatcagcaag
attaaccctgagtgtgatagtgtcactgactgcattaacgaggctgatgagaagaactgt
gactgtgggatgcgtccaggggtgggcacccaaaggattgtgggtggggtgacggctcga
aggggggagtggccgtggcttggcagcctgcagtaccagcgctcacaccgctgcggagcc
actctcgtacactccaagtggctcctgactgctgcccactgcttcaaaagtgactccggc
cctggcagctggtctgtgagcctgggttcagtactgagatccggggtgggagctctagtc
atccctatccagaggatcataatgcacccgggcttcaacagcacaaacatgaacaacgat
gtggccctcctggagctggctgtcccggcacccaggtcctacaccatccaggcggtgtgc
ctgccctcgccggtacaccgtttccacagggacaatgagtgctacatcaccggttggggc
tccacgagggagggaggttctctgaccaacctgcttcagaaagctccggtgaacattatc
gagcagtccgactgcctacaggcctatggcaatggcctcacccccggaatgatgtgcgcc
ggttacatggaggggggcaaagacacatgccttggagattctggtggcccactgacatgt
cgtgaaccctctggccagtggtttgttgccggagtgaccagctggggacacggctgtgga
cgcagtggtttcccaggagtctacatacaggtcactgccatcagggaatggatatctgac
tacctccccttctga

DBGET integrated database retrieval system