KEGG   Esox lucius (northern pike): 105014126Help
Entry
105014126         CDS       T04894                                 

Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
els  Esox lucius (northern pike)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    105014126
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     105014126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 605 aa AA seqDB search
MNLNLKMRVFPVCRWAFILILTLPICVGEEVEKDTSTNVVNPCCYYPCQNWGVCVRFGTD
QYQCDCTRTGFYGQNCTTPEFWTGVYLLLKPNSDTVHYILTHFQLLWSVINRTFLRDWLM
TLVLTVRSNLIPSPPTFNSRYGYISWESYCNVSYYTRILPPVPEDCPTPMGTKGKSVLPD
PKLVVEKFLLRREFRPDPQGTNLMFAFFAQHFTHQFFKTKKSMGMGFTRALGHGVDAGHI
YGDNLVRQLNLRLLKDGKMKFQVIKGEIYPPTVSEAPVNMNYPPGHPEEQRLAIGQEVFG
LLPGLTLYATLWLREHNRVCDILKAEHPTWGDEQLFQTARLIIIGQTIRIVIEEYVQHLS
GYLLDLKFDPSLLFKSTFQYRNRIAVEFNQLYHWHPLMPDSFQINGEVVPYSQFIFNTSI
VTRYGVEKLVEAFSRQYAGQIGGGKNMHPVVTKVAEGVIEESRALRLQPFNEYRKRFKLK
PYTSFTEFTGEEEVARELEELYGDIDALEFYPALMLEKTRHQAIFGESMVEMGAPFSLKG
LLGNPICSPEYWKPSTFGGQTGFDIVNSASLKKLVCLNSKWCPYVAFHVPQPGKEEPAKK
PSTEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaaatcttaaaatgagagtatttccagtgtgcagatgggcgtttatcctgata
ctaacgttacctatatgtgttggggaagaggtagaaaaagacacctctaccaatgttgtg
aatccttgttgctattatccctgtcagaactggggcgtgtgtgtcaggttcggaacggac
cagtatcaatgtgactgcacacggactggcttctatggacagaactgcacaacccccgag
ttctggactggagtgtatctgctgctgaagccgaactctgatacggtccactacatcctt
acgcacttccagcttctgtggagtgtcatcaaccggacctttctgcgggactggctcatg
actctcgtactcacagtgagatcgaatcttatccccagtcctccgacattcaactcccgt
tatggatacatcagttgggaatcctactgcaatgtctcctactacacccgtatcctaccc
ccggtgccagaagactgccccacccccatgggtaccaaaggaaaatctgtcctcccagac
ccgaagctggtagtggagaagttcctgctgagaagggagttcaggccagatccacaggga
accaacctgatgtttgcattcttcgcgcagcacttcacccatcagttcttcaagaccaaa
aagagcatgggcatgggcttcaccagggctctgggccacggggtggatgccggccatatc
tatggggataatctggtgcgccagctgaacctgaggcttcttaaagatgggaagatgaaa
ttccaggtaattaaaggtgagatttacccaccaacagtgtctgaggcaccagtgaatatg
aactaccctcctgggcatccggaggagcagcgcttggccatcggccaggaggtgtttggg
ctcctccccggcctcaccttgtacgccaccctttggctgagggagcacaaccgtgtctgt
gacatcctgaaggcagagcaccccacctggggggatgagcagctcttccagacggccagg
ctcattatcataggtcagaccatccgaatagtgattgaggagtacgtgcagcacctgagc
ggttatcttttggatctgaaattcgacccatccctgctcttcaagtccactttccagtac
aggaaccggatcgccgtggagttcaaccagttgtaccactggcacccgttgatgccagac
agttttcagatcaatggggaggtggtgccctactcccagttcatcttcaacacctccatc
gttacacgctatggtgtagagaaactagtggaggctttttcacgccagtacgccggacag
attggaggtgggaagaacatgcatccagtggtaaccaaggtagctgagggggtcattgaa
gaatcccgagctctgcgtctccaaccctttaacgagtacaggaagaggtttaaactgaag
ccctacacatctttcactgaatttactggggaggaagaggttgccagggagctggaggag
ctctatggtgacatagatgcgctggagttctaccccgccctcatgctggagaagacacgc
caccaagccatatttggtgagagcatggtggaaatgggagctccgttctccctgaaaggc
cttctaggtaacccaatctgttcccctgagtactggaagcccagcacgtttggtggccag
acaggctttgatattgtcaactcagcctcgctgaagaaactggtgtgtctgaatagtaag
tggtgtccgtacgtagccttccatgttcctcaacccgggaaggaggagcccgccaagaaa
ccatccactgaactgtag

DBGET integrated database retrieval system