KEGG   Esox lucius (northern pike): 105021332Help
Entry
105021332         CDS       T04894                                 

Definition
(RefSeq) putative hexokinase HKDC1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
els  Esox lucius (northern pike)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:els00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105021332
   00051 Fructose and mannose metabolism
    105021332
   00052 Galactose metabolism
    105021332
   00500 Starch and sucrose metabolism
    105021332
   00520 Amino sugar and nucleotide sugar metabolism
    105021332
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105021332
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    105021332
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105021332
Membrane trafficking [BR:els04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105021332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 921 aa AA seqDB search
MFAVHLLSFYFSKLQEDQIKKVDRFLYAMRLSDEQLMDISARFHAEMEKGLSSESNATAA
VKMLPTHVFSTPDGSEEGEFLALDLGGSKFKVLRVKVSDNGKRSVEMESETYPIPDEVMN
GRGTDLFVHVAESLKDFIQRKHINQKRKPLGFTFSFPCGQSKVDEGVLLSWSKNYKARGV
VGTNVVESLRHAIDSVGEVDVDVLALVNDTVGTMMTCGYDDQHCEVGVIVGTGTNACYME
EMRHIDLMEGDEGRMCINTEWGAFGDDGALDDFITQFDREIDAASTNPGKQLFEKMVSGM
YMGEMVRLILLKMAKEGLLFDGKVSDALRTKGKFHTKHITLIEQYKEGLKNTKDILLELG
LSPSEDDCVAVQHVCTIVSFRSANLCAAALAAVLNRVRRSRKLKRLRITVGVDGTVYRMH
PQYPKRLHKVVRRLVPECHVRFVLSESGSSKGAAMVTAVAQRLAAQRKEIDDTLALLSLS
PENLQQVRDQMRVELERGLRKDSHSTACVKMLPSFVYRTPNGTERGKFLALDLGGTNFRV
LVVKIRSGIRKSVRMYNKIYSIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGF
TFSFPCRQTGIDKGSLVSWTKGFKATDCEGNDVVDMLREAIKRRNEFDLDIVAVVNDTVG
TMMTCAYEDPKCEIGLIAGTGSNVCYMEEMRNIETVEGDEGRMCINTEWGGFGENDCMEN
IRTRFDREVDEGSLNKGKQRFEKMTSGMYLGEIVRQILIDLTSRGLLFRGRITEPLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLNHLQITVGVDGTLYKLHPHFSGILQNTVKTLAPECDVEFVLSEDGSGKG
AALITAVARRQKTKRNGLGSD
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtgcacttgctctcgttctatttctccaagctgcaggaggaccagatcaag
aaggtggaccgcttcctgtatgccatgcggctctctgatgaacagctaatggatatttcc
gctcgctttcacgcggagatggaaaaaggcctgtccagtgaaagcaacgccacagcggca
gtgaagatgctgcccacgcatgtcttctcaacccctgacggatcagaggagggggagttc
ctggccttggatctgggtggctccaagttcaaagtgctccgggtgaaggtgtctgacaat
gggaagaggtcggtggagatggagagcgagacctaccctatcccagatgaagtcatgaat
ggtcgtgggacagacctgtttgtccatgtcgctgagtctctgaaagacttcatacaaagg
aagcacatcaaccagaagagaaaacctttgggctttaccttttccttcccttgtggacag
tccaaagttgatgagggagtgctgttgtcatggtccaagaactacaaggccagaggtgtc
gttgggaccaatgtggtggagtccttgagacatgctatcgacagtgttggggaagtggac
gtagacgtcctggcccttgttaatgacacagtagggaccatgatgacctgtggctacgac
gaccagcattgtgaagtgggggtcatcgtaggcacaggtactaacgcctgttacatggag
gagatgagacatatcgacctgatggagggagacgagggcaggatgtgtatcaacactgag
tggggggccttcggggacgatggggcgctcgatgacttcatcacgcaatttgaccgagag
attgacgccgcctccaccaaccctgggaagcaactgtttgagaagatggtgagtgggatg
tacatgggggagatggtgagactcattctgttgaagatggccaaggagggactactgttt
gacggcaaagtttcagacgctctacgcaccaaagggaaatttcacaccaaacacatcact
ttaatcgaacagtacaaagaagggcttaagaacaccaaggacatcctgttggagcttggc
ctgtcgccctcagaagatgactgcgtcgccgtccaacacgtctgcaccatcgtgtccttc
aggtcagccaacctctgtgctgcggcactggctgccgtactcaaccgcgtccggcggagc
aggaagctgaagaggctacggatcaccgtcggggtcgacgggaccgtgtaccgaatgcac
ccgcaatatcccaagaggctgcacaaggtggtgcgtcggttggtgcccgagtgccacgtg
cgctttgtgctgtcggagagtggcagcagcaagggggctgccatggtaacagcggtggct
cagagactggcggcccagaggaaggagattgacgacacgctggcactcctcagcctgagc
ccggagaacctgcagcaggtcagggaccagatgagagtggagctggagaggggccttagg
aaggattcccacagcacggcctgtgttaaaatgctgccctccttcgtgtacagaacaccc
aacgggacagagcgaggaaagttcttggctctggacctgggaggaactaacttccgggtg
ctggtggtgaagatccggagtggaataagaaagtctgtccgcatgtacaacaagatctac
tccatcccgctggagatcatgcaaggtacaggagaggagctcttcgaccacattgttcag
tgcatctcggatttccttgactacatggggatgaagaatacccgtcttccgcttggtttc
acattctctttcccctgcagacagactggaatcgataagggaagtttggttagctggacc
aaggggttcaaagctacggactgtgaaggaaatgatgttgtagacatgctgcgagaggct
atcaaaaggaggaatgaatttgatcttgacattgttgctgtggtgaatgacacagtgggt
acaatgatgacatgtgcatatgaagaccccaagtgtgaaataggactcatagctgggacg
ggaagtaatgtgtgttacatggaggagatgaggaacattgagacggtggagggagacgag
ggaaggatgtgtatcaacaccgagtgggggggttttggggagaatgactgcatggagaac
attcggaccaggtttgacagagaagtggacgagggctcactgaacaagggcaaacagagg
tttgagaagatgaccagtggcatgtacctaggagagatcgtgaggcagatccttattgac
ctaaccagtcgaggccttctgttccgaggccgcatcacagagcctctaaaaaccaggggg
atctttgaaaccaagttcctgtcccagattgagagcgacagattggcactgcttcaggtg
aggtccatcctgcagcacctgggtctggacagcacgtgtgacgacagcatcatcgtcaag
gaggtgtgtggcgtcgtgtctcgccgggcggctcagctctgtggggccggaatggccgct
gtcgtcgataaaatccgggagaaccgcgggctgaaccacctgcaaatcactgtgggggtg
gacggaacactctacaaactgcatccacatttctcaggaatcctccagaacacagtcaag
actctggcaccagagtgcgatgtggagtttgtcctatcagaggatggcagtgggaaaggg
gctgctctcattacagctgtggcacgtagacagaagaccaagaggaacgggttgggttct
gattga

DBGET integrated database retrieval system