KEGG   Escherichia coli UM146: UM146_20415Help
Entry
UM146_20415       CDS       T02000                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
elu  Escherichia coli UM146
Pathway
elu00020  Citrate cycle (TCA cycle)
elu00310  Lysine degradation
elu00380  Tryptophan metabolism
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01120  Microbial metabolism in diverse environments
elu01130  Biosynthesis of antibiotics
elu01200  Carbon metabolism
Module
elu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UM146_20415 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    UM146_20415 (sucA)
   00380 Tryptophan metabolism
    UM146_20415 (sucA)
Enzymes [BR:elu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     UM146_20415 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II YihI
Motif
Other DBs
NCBI-ProteinID: ADN73413
LinkDB All DBs
Position
4265793..4268537
Genome map
AA seq 914 aa AA seqDB search
MENMTSPGTLLSGDNATWLEEYYQTWLRTPEQLPEDWRRFFLSPELTVQSVSGDNNVSGA
TLKKQAAVIQLINAWRTQGHLRAKLDPLGLNPPADVPSLQPGFWGLSEEDLLQEFSVTFG
AHTTQMPLKQLLNLLEQAWAGSQAYELAHLENREEINWLLSRIESSNAPQADAQTCIARF
EKLMAAETLERYLHTRYVGQKRFSLEGGESAIPALDTLTKRLRAQGVEEMVIGMAHRGRL
NVLVNLLNKDPAQLFAEFEGKQTIGSGSGDVKYHMGYSSNLETPAGSLHVALAYNPSHLE
IVNPVVLGQVRARQERRGEDGQAKVVGVLIHGDSALGGLGVNQTTFNLSQTQGYGTGGTL
HLVINNQIGFTTSRLQDMRSSRYCTDIAKMVAAPIIHVNGDDVDAVCQVMELACEWRDTF
RRDIIIDICCFRKHGHNESDEPRLTQPQMYQAVDAHPGTLARYGESLARRGLLTQAQQDE
MTARYRDWLDSCQKREPQPLKPAIHSFSANWYGLTNPHWSAPVSTALPRQKLAAYGEIIS
TLPPDVVAHPTIKRQLALRQDMAAGTQPIDWGMAEMLAYASLVDAGVGVRLSGEDSGRGT
FSHRHAVVHHQTEARRYLPLQHIRAGQASFDVYDSVLNEEALLAFEYGYSTSAPQQLVIW
EAQFGDFANGAQVAIDQFISSGETKWDRYSGLTILLPHGYDGQGPEHSSARPERWLQLCA
ENNMQVVMPSESAQMFHLLRGQALRPMRKPLVIMMSKRLLRFKGAMSELSEFTDGAYKPV
VTDPQLHQSQKVKRVILCSGQVYYDVLEARKQRECEDEVAIVRLEQLYPFPVAELNDVLA
SWPNCCEWIWLQEEPENQGAWRQIRHELAALKINTPYWQYAGRPAVAAPATGYGRVHKQQ
IDEFLAAAFADIQP
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggagaacatgacctcgcccggcacgctgcttagtggagataacgcgacctggcttgaa
gagtactaccagacctggttgcgtacgccggaacaactcccggaagactggcggcgtttt
tttctttcacctgaactgactgtccaaagcgtatccggtgataacaacgtcagcggtgcg
acgttaaaaaaacaggctgcggtaatacaactgatcaatgcctggcgcacgcaggggcat
ctgcgcgcaaagcttgatccacttggtttgaatcccccagctgacgttccctccctccag
cctggtttttggggattaagcgaagaagacttgttgcaggagtttagcgtcacctttggc
gcacacaccacgcaaatgccacttaagcaactgcttaacctgctggagcaagcctgggcc
ggtagccaggcttatgaacttgctcatctggaaaatcgtgaagaaatcaactggttgtta
tcacggattgagagcagcaatgcgccacaagctgatgcccaaacctgcattgcccgtttt
gaaaaactgatggcggcagagacgttagagcgttatctgcatacccgttatgttgggcag
aaacggttttctctggaagggggcgaaagtgcaatcccggcgctcgatacgctgacaaaa
cgcctgcgtgcgcaaggtgtggaggaaatggtcattggcatggcgcaccggggaagactt
aatgttctggttaatctgttgaataaagacccggcacagctttttgctgagtttgaaggc
aagcagacgatcggcagtggttcaggcgatgtgaaataccacatggggtattccagcaat
ctggaaacacctgccggttcgctgcatgtggcgctggcgtataacccctcacatctggag
atcgtgaatccggtggtgctgggccaggtgcgagccaggcaggaacgccgtggtgaggat
ggtcaggcaaaagtggtgggcgtacttattcatggggattccgcgttgggcggcctcggc
gtcaaccaaaccacgtttaacttatcgcagactcagggctacggcactggcggtacgcta
catctggtgattaacaatcagattggcttcaccacttcccgcttgcaggatatgcgttct
tcacggtactgcaccgatattgccaaaatggtagcggccccaattatccacgttaatggc
gatgacgttgacgctgtttgccaggtaatggaactggcgtgcgaatggcgagacaccttc
cggcgcgacatcatcatcgatatttgctgcttccgtaagcacggacacaacgaaagcgat
gagccacgtcttacccagccacaaatgtatcaggcagtggatgctcaccctggtacgctc
gcccgttatggtgaatctcttgcccgccgcggcctgttaactcaggcgcaacaagatgag
atgacggcacgctatcgcgactggctggatagctgccagaaacgtgaaccgcagcctctc
aaacctgcaattcactcttttagcgctaactggtatgggttgaccaaccctcactggagc
gccccggtatctacggcattgcctcggcaaaagctggcagcgtatggtgaaatcatttct
acactgccacccgatgtggtcgcacatcctaccattaaacggcaactggcgttacgccag
gatatggccgcaggtactcagccaatagactggggaatggctgaaatgctggcctatgca
tcgcttgtggatgcgggtgttggtgtgcgtctttctggtgaagactcagggcgtggcacg
ttcagtcatcgccatgcagtggtacatcatcaaactgaagcccgtcgttatctgccgtta
cagcatatccgcgctggtcaggcatctttcgatgtttatgattcggtgcttaatgaagaa
gcgctcttagcctttgaatatggctattcaacgtctgcgcctcagcaactggttatttgg
gaagcgcagtttggtgactttgccaacggcgctcaggttgctattgaccagtttatctcg
tctggcgaaaccaagtgggatcgctatagcggtttaaccattcttctgccgcatggctat
gacggacaagggccggagcactcttctgcgcgtcctgagcgctggctgcaactgtgcgca
gaaaacaacatgcaggtggtgatgcccagtgagtcagcacaaatgttccatttgctgcgc
ggtcaggcattacgcccaatgcgcaaaccgttagtgataatgatgagtaagcgtttactt
cggtttaaaggcgctatgagcgagctttctgaattcactgatggcgcttataaaccggta
gtcaccgatccgcaattgcatcagtcccagaaagttaagcgcgttattttgtgtagcggc
caggtctattacgacgtactggaagcccgtaagcagcgtgagtgtgaagatgaggtagcg
attgttcgcctggagcaactctacccgttcccggtcgcagaactgaatgatgttctggcg
agttggccgaactgctgcgaatggatttggttgcaggaagagccagaaaaccagggcgcg
tggcggcagattcgtcatgagctggcggcactgaaaattaacactccttactggcagtat
gcaggccgcccggcagtggcagctccggcgacagggtatgggcgtgtacataaacaacaa
atcgacgaatttcttgctgctgcgtttgcagatattcagccatga

DBGET integrated database retrieval system