KEGG   Walczuchella monophlebidarum: FNIIJ_224Help
Entry
FNIIJ_224         CDS       T03207                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
elv  Walczuchella monophlebidarum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FNIIJ_224 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    FNIIJ_224 (sucA)
   00380 Tryptophan metabolism
    FNIIJ_224 (sucA)
Enzymes [BR:elv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FNIIJ_224 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(218057..220777)
Genome map
AA seq 906 aa AA seqDB search
MDRYSFLNTVHPKLIEELYHRYLHTPDQIEPSWRAFFQGFDFALATYNRNDNKDSQKILK
EFQVLNLIQAYRSRGHLFTKTNPIRSRREYSPNLDIEQFGLGIEDLETVFEAGKLVGKEP
CTLANILTHLKTVYCESIGIEYIHLRNPENIYWIQQWLNKNENKPSLSVEEKKNLLNKLT
EAVVFENFLHTKFVGQKRFSIEGNESLLPAVDELIEYASICYEAEEFVIGMAHRGRLNVL
ANILKKSLEEIFSEFDGKEYDEKVFSGDVKYHLGATIKRNNRHGKSIKISLAPNPSHLET
VDTVVEGLARAKIDHYYKKNYNHLLPILIHGDAAISGQGLIYEIVQMSQLEGYKTGGTIH
IVVNNQMGFTTDYIDGRSSIYCTDIGKVTLSPVLHVNADDVESVIHAIHFAVDFRMHYQR
DVFIDILGYRKYGHHEGDDPRFTQPSLYKAIANQINARDIYKKKLQKENIIDNAYIQVIE
QDLSKKLENSYERAKNRKRNQLNYFLPSEWNIFSPDQSSQVFKEMDTSFPIELLTEIGLI
ISSLPKTYHFYKKIEKILAQRKEMIKNGNIIDWGMAELLAYGTLLYENFDIRLSGEDVER
GTFSHRHAVIKSENFENKYITLNHLRVGQGLIQIYNSPLSEYGVMGFDYGYAMASPNTLT
LWEAQFGDFSNGAQIIIDQYLSAAEDKWKIQNGLVLLLPHGYEGQGSEHSSARIERYLQL
CGRYNMFILNCTNPANFYHALRRHMKFPFRKPLVIFTPKSLLRHPKCVATLANLATDRFY
PIIDDDTDDPKRITQIVICSGKIYYEILKEKEITRSMHIALIRLEQLYPIQKELLKRILE
KYPKCKRWMWVQEEPKNMGPWPYISYTLKSIPFEIISRDESASPASGSYSNFIKTQKEII
EKVFRS
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttattcttttctgaataccgttcatccaaaactcattgaagagctctatcat
agatatcttcatactccagaccagattgagccaagttggcgagctttttttcaaggtttt
gattttgccttggcaacctacaatagaaatgataacaaggattctcaaaaaattctgaag
gaattccaggtcttaaatttgatccaagcctatcggagtcgtgggcatctttttacgaaa
actaatccaattaggagtaggcgtgaatattctccgaatttagatattgaacaatttgga
cttgggatagaagatcttgaaacggtttttgaagctggaaaacttgtcggaaaggaacct
tgtacgctggctaatatattgactcatctgaagactgtatattgcgaatctataggaata
gaatatatacatttgcgaaatccagaaaatatttactggattcagcaatggcttaataaa
aatgagaataaaccgtctctttcggttgaagaaaaaaaaaacttactgaataaactcact
gaagcagtagtatttgaaaactttttacacactaaatttgtaggtcagaaaagattttct
attgaagggaatgaatctttgttacctgctgttgatgagcttatagaatatgcctcgatt
tgttatgaagccgaggaatttgttatagggatggctcatagaggtagattaaatgtatta
gctaatattttaaaaaaaagcttagaagaaatatttagcgaattcgatggaaaagaatat
gatgaaaaagttttttctggagacgtcaaatatcatttaggagctacgataaaacgaaat
aaccgtcatgggaaatctataaaaataagtctagcaccgaatccttcgcatcttgaaact
gtagatactgtggtagaaggtctcgcaagagcgaagatagatcattactataagaaaaat
tataaccatctgttacccattcttatacatggcgatgctgctatttctggacaaggtctt
atttatgaaattgtgcaaatgtctcaactagaaggttataaaacaggaggaacgatacat
atagtagtcaataatcaaatgggatttaccactgattatatagatggtcgttctagtatc
tattgtactgatataggaaaagttaccctttccccagtattacacgtcaatgctgatgat
gtagaatccgttattcacgctatacattttgctgtcgattttagaatgcattatcaaaga
gatgtttttattgatattttgggatataggaaatatggacaccatgaaggagatgacccc
aggtttacacaaccttcactttataaggctattgcgaatcagattaacgctagagatatt
tacaaaaaaaaattacaaaaagaaaacatcatagataatgcatacattcaagttattgaa
caagatttgagtaaaaagctagaaaatagctatgaaagagctaaaaataggaagcgaaat
caattaaattattttttgccttcagaatggaatattttttcaccagaccaatcttctcag
gtattcaaagagatggatacaagttttcctatagaactactaacagaaataggcttaata
ataagcagtttaccaaaaacttatcatttctataaaaaaatagaaaaaattttagcccaa
agaaaagaaatgataaaaaatggtaatatcattgattggggtatggcagaacttttagct
tatgggactttattatatgaaaatttcgatatccgtctttctggagaagacgttgagagg
gggactttttcccatcgtcatgcagtaattaaatccgaaaattttgaaaataagtatatt
acactaaaccatcttagagtaggacaaggtcttatacaaatatataactccccactttct
gaatacggagtaatgggatttgattatggttatgctatggcttctcctaataccctaact
ctttgggaagcacaatttggagattttagcaatggagctcaaattattatagatcagtat
ttatctgctgcagaagataaatggaaaatacaaaacggattagtactgttattacctcat
ggctatgagggacaaggatcagagcactcttctgcacgtattgaacgatatcttcaattg
tgcggccgatataatatgtttatactaaactgtactaatccggccaatttttatcacgct
ttacgaagacatatgaaatttccttttagaaaacccttagttattttcacccctaaaagt
ctcttaagacatcctaaatgtgttgctacattagcaaatctggctacagatagattctat
ccaatcatagacgacgacactgatgatcctaaacgaataacacaaatagttatttgttca
ggaaaaatatattatgaaatccttaaggaaaaagaaatcactagatctatgcatattgca
ctaatacggttagagcagttatatcctatccaaaaagaattattaaaaagaattttggaa
aaatacccaaaatgtaaacgatggatgtgggttcaagaagaacctaaaaacatgggacct
tggccttacatatcttatacactaaaaagcatcccttttgagattatatctcgtgatgaa
agtgcttctccagccagtggttcttatagtaattttataaaaacacagaaggaaattata
gaaaaagtttttagatcatga

DBGET integrated database retrieval system