KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0526Help
Entry
CDCO157_0526      CDS       T02122                                 

Definition
(GenBank) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDCO157_0526
   00220 Arginine biosynthesis
    CDCO157_0526
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CDCO157_0526
Enzymes [BR:elx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CDCO157_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
578650..579582
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTSDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENAEQRWQRILHIQQQLAGELVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtgcctggtcaactg
gcagcagtggctatcgtgaccagcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctgtcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatgccgaacaacgctggcagcgaatttta
catatccaacagcaactggctggtgagctggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcatc
aatactgttgaactggcaacgcttggcgcgacgctggcggcgggtggtgtgaatccgttg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgtgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggagtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system