KEGG   Escherichia marmotae: C1192_17740Help
Entry
C1192_17740       CDS       T05353                                 

Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ema  Escherichia marmotae
Brite
Enzymes [BR:ema01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C1192_17740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-ProteinID: AUT28751
UniProt: A0A2I8C885
LinkDB All DBs
Position
3439504..3440124
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPVLGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcaggcctacgtcaacaacgctaac
gcggcgctggaaagcctgccagaatttgccaacctgccggttgaagagctgatcactaag
ctggatcaactgccagcagacaagaaaaccgttttgcgcaacaacgcaggcggccatgct
aaccacagcctgttctggaaaggcctgaaaaaaggcaccaccctgcagggcgatctgaaa
gcggctatcgaacgtgatttcggttccgttgataacttcaaagcagaatttgagaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaactggcg
gtggtttctactgctaaccaggactccccgctgatgggcgaagctatctctggcgcttcc
ggcttccctgttctgggtctggatgtgtgggaacacgcttactacctgaaattccagaac
cgccgtccggactacattaaagagttctggaacgtggtgaactgggacgaagcagcggca
cgtttcgccgcgaaaaaataa

DBGET integrated database retrieval system