KEGG   Elizabethkingia anophelis FMS-007: M876_17345Help
Entry
M876_17345        CDS       T03946                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
emn  Elizabethkingia anophelis FMS-007
Brite
Enzymes [BR:emn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M876_17345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: AKH96319
LinkDB All DBs
Position
complement(3724046..3724555)
Genome map
AA seq 169 aa AA seqDB search
MKNLKILSLGILGAVFTVSCATKEVSYAITPKSGTATGGTVTFKQMGKNVVMNVDAKGLT
PGVHAIHIHDKPDCSAPDGTSTGGHWNPAGSDHGKWGAEHFHMGDIGNLNADDKGNAKLT
FKTSKWCIGCTDETKNILNHGLIIHAAADDFHTQPTGNAGGRVGCVEIK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaaaaatattatccttaggcattctgggagctgtatttacagtttcgtgt
gctactaaggaggtaagttatgctattacccctaaaagtggaacagcaacaggaggaacc
gtaacctttaaacagatgggcaaaaatgtagtcatgaatgttgatgcaaagggattaacg
ccaggagtacatgctattcacatccatgataagccagactgttcagctccagacggaaca
tctacgggtggacactggaaccctgcaggaagcgaccatggaaaatggggagcagaacat
ttccatatgggtgatataggtaaccttaatgctgacgacaagggtaatgcaaaattaact
tttaaaacaagcaaatggtgtattggttgtacagatgaaacaaagaatatcctgaatcac
ggattaatcattcatgcagctgctgacgatttccatactcagcctacgggaaatgcaggc
gggagagttggatgtgttgagattaaataa

DBGET integrated database retrieval system