KEGG   Enterococcus mundtii: EMQU_2355Help
Entry
EMQU_2355         CDS       T02931                                 

Gene name
tdk2
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
emu  Enterococcus mundtii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EMQU_2355 (tdk2)
Enzymes [BR:emu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EMQU_2355 (tdk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2423393..2423977)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQNKPVVLMTSGIDTRDGVGVVSSRIGLKREAI
PIFETTDVFEVIQQMEHPPFCVLIDEAQFLTKEHVLAFTRIVDELNIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCHKKAMMNLHYIDGTPVYEGDQVQIGGNEAYYPVC
RKHYFHPLMITEGD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactattttttaagtacggcgcaatgaacagcggcaagacaatcgagatctta
aaagtcgcacataattatgaagaacaaaacaaaccggttgttttgatgaccagcggaatc
gatacaagagatggcgttggcgtagtttcaagcagaatcgggctgaaacgtgaagcaatt
cccatttttgaaacgaccgatgtatttgaagtcatccagcagatggaacatccaccattc
tgtgtattgatcgatgaagcgcagttcttaacaaaagaacatgtcttagcattcacgaga
atcgttgatgaactcaatattccggtgatggcgttcggattaaaaaatgattttagaaat
gaattatttgaaggatcgaaatatttattgctttatgcagacaaaatcgaagaaatgaaa
acgatctgttggttctgccataaaaaagcaatgatgaatttacattatatagacggaaca
ccggtgtacgaaggagatcaagtccaaattggtggcaatgaagcctattatcccgtatgt
cgaaaacactattttcatccattgatgatcacagaaggagattaa

DBGET integrated database retrieval system