KEGG   Enterobacter sp. FY-07: AKI40_0463Help
Entry
AKI40_0463        CDS       T04405                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
enf  Enterobacter sp. FY-07
Brite
Translation factors [BR:enf03012]
 Eukaryotic Type
  Elongation factors
   AKI40_0463
 Prokaryotic Type
   AKI40_0463
Mitochondrial biogenesis [BR:enf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AKI40_0463
Exosome [BR:enf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AKI40_0463
  Exosomal proteins of breast cancer cells
   AKI40_0463
  Exosomal proteins of colorectal cancer cells
   AKI40_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
495359..496543
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgtcggcactatcggccac
gttgaccatggtaaaactaccctgactgctgccatcactaccgttctggcaaaaacctac
ggtggtaacgctcgcgcattcgatcagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggtagtagctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgaactgctgtctcag
tacgatttcccgggcgacgacactccgatcgttcgtggttctgcactgaaagcgctggaa
ggcgaagcagagtgggaagcgaaaatcatcgaactggctggttacctggattcttacatc
ccggaaccagaacgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtaggt
gaagaagttgaaatcgttggtatcaaagacaccgcgaaatccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggcgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggttcaatcaag
ccgcacaccaaattcgaatctgaagtttatatcctgtccaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtacaactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgattcacccgattgcgatggatgatggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgtagcaaaagttctgggctaa

DBGET integrated database retrieval system