KEGG   Enterobacter sp. FY-07: AKI40_4836Help
Entry
AKI40_4836        CDS       T04405                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00620  Pyruvate metabolism
enf00680  Methane metabolism
enf01100  Metabolic pathways
enf01120  Microbial metabolism in diverse environments
enf01200  Carbon metabolism
Module
enf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:enf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKI40_4836 (ppc)
  Energy metabolism
   00680 Methane metabolism
    AKI40_4836 (ppc)
Enzymes [BR:enf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AKI40_4836 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMO51209
UniProt: A0A140IGV3
LinkDB All DBs
Position
4969878..4972553
Genome map
AA seq 891 aa AA seqDB search
MRWGVWGNMNEQYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEAN
RQELLTTLQNLSNDELLPVARAFSQFLNLANTAEQYHSISAKGEAANNPEVIARTLRKLK
DQPNLNEATIIKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNTDIADYERH
QLMRRLRQLIAQSWHTDEIRRYRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENL
NYKLPVDFVPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQLLISELSM
VECTDELRELAGAEGAREPYRYLMKKLRSDLMATQAWLEARLKGQKLPKPEGLLTQNEQL
WEPLYACYKSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRY
LGIGDYESWSEADKQAFLIRELNSKRPLLPRQWEPSDETREVLDTCRVIAEAPRGSIAAY
VISMAKTPSDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQ
GKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPA
HAALLSQPPGSLKGGLRVTEQGEMIRFKYGLPEITISSLSLYTSAIMEANLLPPPEPKTE
WRHIMDELSDISCDMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESL
RAIPWIFAWTQNRLMLPAWLGAGAALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFS
KADLWLAEYYDQRLVKPELWALGAELRKLLEADIKVVLAIANDSHLMADLPWIAESIQLR
NIYTDPLNVLQAELLHRSRLAEEEGKEPDHRVEQALMVTIAGVAAGMRNTG
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgagatggggtgtctggggtaacatgaacgaacaatattccgctttgcgtagtaatgtc
agtatgctcggcaaactgctgggagataccatcaaggatgcactgggtgagaacattctc
gaccgtgtagaaacaatccgtaagctgtccaaatcttctcgcgccggtaacgaagccaat
cgtcaggaactgctcaccacgttgcagaatctctccaatgacgagctgctgccggtggcg
cgagcgttcagccagtttctgaaccttgccaacactgccgagcaataccacagcatctcc
gcgaaaggcgaagccgccaataacccggaagtcattgcccgcactctcagaaaactgaaa
gaccaaccgaatcttaacgaagccacgatcattaaagccgtggaatccctgtcgctggag
ctggtgctgaccgcacacccgaccgagatcacccgtcgtacattgatccataaaatggtg
gaagtgaatgcctgcttaaaacagctggataacactgacattgccgactatgagcgccac
cagttgatgcgccgtctgcgccagcttattgcgcagtcctggcataccgatgaaatccgc
agatatcgtccaagcccggtagacgaagccaaatggggcttcgcggtagtggaaaatagc
ctatgggaaggcgtgccgaactaccttcgcgaactgaacgaacaactggaagagaacctc
aattacaagctgccggtcgactttgtgccggtacgctttacgtcatggatgggcggtgac
cgcgacggcaacccgaacgtgactgccgatatcacccgccatgtgctgctgctcagccgc
tggaaagccaccgacctgttcctcaaagatgtgcagttgctgatttccgagttgtcgatg
gtggagtgtaccgacgagctgcgggaactggctggcgctgaaggtgctcgcgaaccgtat
cgttatctgatgaaaaagctgcgcagcgatctgatggccactcaggcctggctggaagcg
cgtctgaaaggtcagaagttgccgaaacctgaaggactgctgacgcaaaacgaacagctg
tgggaaccgctttacgcctgttataaatctctgcaagcctgcggcatgggcattatcgcc
aacggcgaactgctcgatacattacgtcgcgtgaagtgttttggcgtcccgctggtacgc
attgatattcgtcaggaaagtacgcgtcataccgaagcgctgggcgaattaacccgttat
ctcggtattggcgactatgagagctggtccgaagccgacaaacaagcattcctgatccgc
gaactgaactcgaaacgcccgttgctgccgcgccagtgggagccaagcgatgaaacccgc
gaagtgctggatacctgccgggtgatcgcggaagcgccgcgtggctccatcgccgcctat
gtgatctccatggcgaagacaccgtccgatgtcctggcagtacacctgctgctgaaagaa
gccggtattggtttcgccctgcctgtcgcgccgctgtttgaaacgctggacgatctgaac
aacgccgacgatgtgatgacccaattgctgaatattgactggtatcgcggctttattcag
ggcaaacagatggtgatgattggctattccgactcggcgaaagacgcaggcgtgatggca
gcaagctgggcgcaatatcaggcacaggatgcgttgatcaaaacctgcgaaaaagccggt
attgaactgacgctgttccacggtcgtgggggttctatcggtcgtggcggcgcgcctgcg
cacgcggcactgctttcacaaccgccaggcagcctgaaaggtggcctgcgcgtgaccgaa
cagggtgagatgatccgctttaaatacggtctgccggaaatcaccatcagcagcctgtcg
ctgtataccagcgcgattatggaagccaacctgctgccgccgccggagccaaaaaccgaa
tggcgccacattatggatgagctgtccgatatctcctgcgatatgtaccgcggctatgta
cgtgaaaataaagacttcgtcccctatttccgttccgccacgccagagcaggagctcggt
aaactgcctctcggctcccgtccggcaaaacgtcgcccgactggtggggtggaatcgctg
cgtgcgatcccgtggatcttcgcatggacgcaaaaccgcctgatgctgccggcatggctg
ggcgctggcgctgcgctgcaaaaagtggtggaagacggcaagcaaagcgagctggaagcg
atgtgccgcgactggccgttcttctcaacccgtctcgggatgctggaaatggtcttctca
aaagccgacctgtggctggcggaatattacgatcagcggctggtgaaaccagagctgtgg
gcgctgggcgcagagctgcgtaagctgttagaagccgatatcaaagtcgtgctggcaatc
gccaacgactcgcatttgatggccgacttgccgtggattgccgagtctattcagctacgt
aacatttataccgacccgctgaacgtactgcaggccgagctgctgcatcgctcacgtctt
gccgaagaagaaggcaaagagccggatcatcgcgttgaacaagcgctgatggtcaccatt
gccggtgttgcagcaggtatgcgtaatactggctaa

DBGET integrated database retrieval system