KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_1603Help
Entry
EBS_1603          CDS       T04530                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:enm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBS_1603 (ppc)
  Energy metabolism
   00680 Methane metabolism
    EBS_1603 (ppc)
Enzymes [BR:enm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EBS_1603 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1737778..1740597
Genome map
AA seq 939 aa AA seqDB search
MTDSFVEACLKKDKALRSRVRLMGNMLGEVVASQSGEEVLHHIERLRKGFIRLRKDPDPG
RLKRLKKLIDRLPPHTLRPVIRAFATYFQLANIAEESFQHRQRRRVAASGKTLWEGSFDQ
CIRQLRDRGINPEQLQDLLEDVRYMPVFTAHPTESKRRAILLQLCRIFEANEGLDSPALT
LDHKDFWERALRTRIQTLWKTNEVRPAKPDVRHEIRMELHHFKASLFDAVPVLYRRLQHA
IERVYGDHPDYHHIELPALLRFGSWIGGDRDGNPNVTAEITAEAILTQHRTILECYLERI
DLLVDTLTHSDQFCTPTPEFNEALAADDAYREAHDAHWPARFTHEPYRRKLYIMKLRLLH
TLKRAAARLAGEPTEALPTGYRSEGDFVRDLELIHDSLASHGDREAAEAELLDLIRLART
FGFYLARLDIRQESTVHTEAVAEILSVLGIENDYAALDETQRMALMGRLIEQPPARPAAD
RLSAMTREVLEVLDVVREMQDSISPRVIGRYVISMAHHASDVQHVMFLAALAGLTGQQGD
DFICRIGVSPLFETIEDLQHIEPVMSHLLDDPVYRRLLEAHSTLQEVMLGYSDSAKDGGI
VASAWSLYQAQQQVIALGLERGVRIRLFHGRGGTIGRGGGPTHQAITSQPAGTVLGQIKF
TEQGEVLSYKYGNKETAVFELTMGLTGLITASLGLVQPVPKDPPAYAETMQRLQEVGERH
YRELTEQTPGFLDYFYEATPVNEIALLNIGSRPSHRKKTDRSKASVRAIAWVFGWAQSRH
TLPAWYGLGKALDDFCNADPANLEALRGLYREWPFFRALLSNTQMALFKADMRIAAEYAE
LAQDQESAQAIYHRIREEHERTCRRILEIAQLDELLDETPLLKRSLQRRDPYLDPLNHIQ
LALLRRYRDENLDEEERERQLDPLLRSINAIAAGMRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcctttgtcgaagcatgcctcaagaaggacaaggccctgcgttcccgggtg
cgcctgatgggtaacatgctgggtgaggtggtggcatcccagtcgggagaagaagtgctg
catcacatcgagcgtctgcgcaagggcttcatccgcttgcgcaaggacccggatccgggc
cggctcaagcgcctgaaaaagctgatcgaccgcctgcccccgcataccctgcggccggtc
atccgcgccttcgccacctatttccagctggcaaacatcgccgaggagagcttccagcac
cgccagcgccggcgcgtggccgcctcgggcaagaccctgtgggaaggctccttcgaccag
tgcattcgccagttgcgcgatcgcggcatcaatcccgagcagttgcaggacctgctcgag
gacgtgcgctacatgccggtgttcaccgcgcatcccaccgaatccaagcgccgcgccatc
ctgctgcaactgtgccgtatcttcgaggccaacgagggcctggacagcccggcgctcacc
ctcgaccacaaggacttctgggagcgcgccctgcgcacccgcatccagaccctgtggaag
accaacgaggtacgcccggccaagccggacgtgcgccacgagatccgcatggagctgcac
cacttcaaggccagcctgttcgatgccgtcccggtgctctaccgccgcctgcaacatgcc
atcgagcgcgtctacggcgatcaccccgactatcatcacatcgagctgccggcgctgctg
cgcttcggctcctggatcggcggcgaccgcgacggcaaccccaacgtcactgccgagatc
accgccgaggccatcctcacccagcatcgcaccatcctggagtgctacctggagcgcatc
gacctgctggtcgacaccctcacccactccgaccagttctgcacccccacgcccgagttc
aacgaggcgctggcagcggatgatgcctaccgcgaggcgcacgatgcgcactggccggca
cgcttcacccacgagccctaccggcgcaagctctacatcatgaagctgcgccttctgcac
acactgaagcgcgccgccgcgcggctggcaggcgaaccgaccgaggccctgccgaccggc
tatcgcagcgagggcgatttcgtccgcgacctggaactgatccacgactcgctggccagc
cacggcgaccgcgaggccgccgaggccgaactgctcgacctgatacgcctggcgcgcacc
ttcggcttctacctggcacgcctggacatccgccaggagtcgacggtacacaccgaggcg
gtggccgagatcctgtcggtgctcggcatcgagaacgactacgccgcgctcgacgagacg
cagcgcatggcgctgatgggccggctgatcgaacagcccccggcgcgcccggcggccgac
cggctgtcggccatgacccgcgaggtgctcgaggtgctcgacgtggtacgcgagatgcag
gacagcatcagcccgcgcgtgatcggacgctatgtcatctccatggcgcaccacgcctcg
gacgtacagcacgtgatgttcctcgccgccctggccgggctgaccggccagcagggcgac
gacttcatctgccgcatcggcgtctcgccgctgttcgagaccatcgaggacctgcaacac
atcgaaccggtgatgagccacctgctcgacgacccggtgtatcgccgcctgctcgaggcc
cacagcaccctgcaggaggtcatgctgggctattccgactcggccaaggacggcggcatc
gtggcctcggcctggtcgctctaccaggcccagcagcaggtgatcgccctgggcctcgag
cgcggcgtgcgcatccgcctgttccacggacgtggcggcaccatcggccgcggcggcggc
cccacccaccaggccatcacctcgcaaccggccggcaccgtactgggccagatcaagttc
accgaacagggcgaggtgctgtcgtacaagtacggcaacaaggagaccgcggtgttcgaa
ctgaccatgggccttaccgggctgatcaccgccagcctcggcctggtacagccggtgcca
aaggacccgccggcctacgcggagaccatgcaacgcctgcaagaggtgggcgagcgccac
taccgcgaactgaccgagcagacgcccggcttcctcgactacttctacgaggccacgccg
gtcaacgagatcgccctgctcaatatcggctcgcgcccctcgcaccgcaagaaaaccgat
cgctccaaggcctcggtgcgcgccatcgcctgggtgttcggctgggcgcaatcacgccac
accctgcccgcctggtacggcctgggcaaggcgctggacgacttctgcaacgccgacccg
gccaacctcgaggccctgcgcggcctgtaccgcgaatggcccttcttccgggccctgctc
agcaacacccagatggcgctgttcaaggccgacatgcgcatcgccgccgagtacgccgaa
ctggcgcaggaccaggagagcgcacaggccatctaccacaggatacgcgaggaacacgaa
cgcacctgccggcgcatcctcgagatcgcgcagctcgacgagctgctcgacgagaccccg
ctgctcaagcgttccctgcaacgccgcgacccctacctggacccgctcaaccacatccag
ctcgcgctgctgcgccgctaccgcgacgagaacctggacgaggaagaacgcgaacgccag
ctcgacccgctgctgcgctcgatcaacgcgattgccgcggggatgcgcaacaccggctga

DBGET integrated database retrieval system