KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_1603Help
Entry
EBS_1603          CDS       T04530                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00620  Pyruvate metabolism
enm00680  Methane metabolism
enm01100  Metabolic pathways
enm01120  Microbial metabolism in diverse environments
enm01200  Carbon metabolism
Module
enm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:enm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBS_1603 (ppc)
  Energy metabolism
   00680 Methane metabolism
    EBS_1603 (ppc)
Enzymes [BR:enm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EBS_1603 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAN69484
UniProt: S6BTU4
LinkDB All DBs
Position
1737778..1740597
Genome map
AA seq 939 aa AA seqDB search
MTDSFVEACLKKDKALRSRVRLMGNMLGEVVASQSGEEVLHHIERLRKGFIRLRKDPDPG
RLKRLKKLIDRLPPHTLRPVIRAFATYFQLANIAEESFQHRQRRRVAASGKTLWEGSFDQ
CIRQLRDRGINPEQLQDLLEDVRYMPVFTAHPTESKRRAILLQLCRIFEANEGLDSPALT
LDHKDFWERALRTRIQTLWKTNEVRPAKPDVRHEIRMELHHFKASLFDAVPVLYRRLQHA
IERVYGDHPDYHHIELPALLRFGSWIGGDRDGNPNVTAEITAEAILTQHRTILECYLERI
DLLVDTLTHSDQFCTPTPEFNEALAADDAYREAHDAHWPARFTHEPYRRKLYIMKLRLLH
TLKRAAARLAGEPTEALPTGYRSEGDFVRDLELIHDSLASHGDREAAEAELLDLIRLART
FGFYLARLDIRQESTVHTEAVAEILSVLGIENDYAALDETQRMALMGRLIEQPPARPAAD
RLSAMTREVLEVLDVVREMQDSISPRVIGRYVISMAHHASDVQHVMFLAALAGLTGQQGD
DFICRIGVSPLFETIEDLQHIEPVMSHLLDDPVYRRLLEAHSTLQEVMLGYSDSAKDGGI
VASAWSLYQAQQQVIALGLERGVRIRLFHGRGGTIGRGGGPTHQAITSQPAGTVLGQIKF
TEQGEVLSYKYGNKETAVFELTMGLTGLITASLGLVQPVPKDPPAYAETMQRLQEVGERH
YRELTEQTPGFLDYFYEATPVNEIALLNIGSRPSHRKKTDRSKASVRAIAWVFGWAQSRH
TLPAWYGLGKALDDFCNADPANLEALRGLYREWPFFRALLSNTQMALFKADMRIAAEYAE
LAQDQESAQAIYHRIREEHERTCRRILEIAQLDELLDETPLLKRSLQRRDPYLDPLNHIQ
LALLRRYRDENLDEEERERQLDPLLRSINAIAAGMRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcctttgtcgaagcatgcctcaagaaggacaaggccctgcgttcccgggtg
cgcctgatgggtaacatgctgggtgaggtggtggcatcccagtcgggagaagaagtgctg
catcacatcgagcgtctgcgcaagggcttcatccgcttgcgcaaggacccggatccgggc
cggctcaagcgcctgaaaaagctgatcgaccgcctgcccccgcataccctgcggccggtc
atccgcgccttcgccacctatttccagctggcaaacatcgccgaggagagcttccagcac
cgccagcgccggcgcgtggccgcctcgggcaagaccctgtgggaaggctccttcgaccag
tgcattcgccagttgcgcgatcgcggcatcaatcccgagcagttgcaggacctgctcgag
gacgtgcgctacatgccggtgttcaccgcgcatcccaccgaatccaagcgccgcgccatc
ctgctgcaactgtgccgtatcttcgaggccaacgagggcctggacagcccggcgctcacc
ctcgaccacaaggacttctgggagcgcgccctgcgcacccgcatccagaccctgtggaag
accaacgaggtacgcccggccaagccggacgtgcgccacgagatccgcatggagctgcac
cacttcaaggccagcctgttcgatgccgtcccggtgctctaccgccgcctgcaacatgcc
atcgagcgcgtctacggcgatcaccccgactatcatcacatcgagctgccggcgctgctg
cgcttcggctcctggatcggcggcgaccgcgacggcaaccccaacgtcactgccgagatc
accgccgaggccatcctcacccagcatcgcaccatcctggagtgctacctggagcgcatc
gacctgctggtcgacaccctcacccactccgaccagttctgcacccccacgcccgagttc
aacgaggcgctggcagcggatgatgcctaccgcgaggcgcacgatgcgcactggccggca
cgcttcacccacgagccctaccggcgcaagctctacatcatgaagctgcgccttctgcac
acactgaagcgcgccgccgcgcggctggcaggcgaaccgaccgaggccctgccgaccggc
tatcgcagcgagggcgatttcgtccgcgacctggaactgatccacgactcgctggccagc
cacggcgaccgcgaggccgccgaggccgaactgctcgacctgatacgcctggcgcgcacc
ttcggcttctacctggcacgcctggacatccgccaggagtcgacggtacacaccgaggcg
gtggccgagatcctgtcggtgctcggcatcgagaacgactacgccgcgctcgacgagacg
cagcgcatggcgctgatgggccggctgatcgaacagcccccggcgcgcccggcggccgac
cggctgtcggccatgacccgcgaggtgctcgaggtgctcgacgtggtacgcgagatgcag
gacagcatcagcccgcgcgtgatcggacgctatgtcatctccatggcgcaccacgcctcg
gacgtacagcacgtgatgttcctcgccgccctggccgggctgaccggccagcagggcgac
gacttcatctgccgcatcggcgtctcgccgctgttcgagaccatcgaggacctgcaacac
atcgaaccggtgatgagccacctgctcgacgacccggtgtatcgccgcctgctcgaggcc
cacagcaccctgcaggaggtcatgctgggctattccgactcggccaaggacggcggcatc
gtggcctcggcctggtcgctctaccaggcccagcagcaggtgatcgccctgggcctcgag
cgcggcgtgcgcatccgcctgttccacggacgtggcggcaccatcggccgcggcggcggc
cccacccaccaggccatcacctcgcaaccggccggcaccgtactgggccagatcaagttc
accgaacagggcgaggtgctgtcgtacaagtacggcaacaaggagaccgcggtgttcgaa
ctgaccatgggccttaccgggctgatcaccgccagcctcggcctggtacagccggtgcca
aaggacccgccggcctacgcggagaccatgcaacgcctgcaagaggtgggcgagcgccac
taccgcgaactgaccgagcagacgcccggcttcctcgactacttctacgaggccacgccg
gtcaacgagatcgccctgctcaatatcggctcgcgcccctcgcaccgcaagaaaaccgat
cgctccaaggcctcggtgcgcgccatcgcctgggtgttcggctgggcgcaatcacgccac
accctgcccgcctggtacggcctgggcaaggcgctggacgacttctgcaacgccgacccg
gccaacctcgaggccctgcgcggcctgtaccgcgaatggcccttcttccgggccctgctc
agcaacacccagatggcgctgttcaaggccgacatgcgcatcgccgccgagtacgccgaa
ctggcgcaggaccaggagagcgcacaggccatctaccacaggatacgcgaggaacacgaa
cgcacctgccggcgcatcctcgagatcgcgcagctcgacgagctgctcgacgagaccccg
ctgctcaagcgttccctgcaacgccgcgacccctacctggacccgctcaaccacatccag
ctcgcgctgctgcgccgctaccgcgacgagaacctggacgaggaagaacgcgaacgccag
ctcgacccgctgctgcgctcgatcaacgcgattgccgcggggatgcgcaacaccggctga

DBGET integrated database retrieval system