KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_09920Help
Entry
ECENHK_09920      CDS       T02315                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00250  Alanine, aspartate and glutamate metabolism
eno00410  beta-Alanine metabolism
eno00640  Propanoate metabolism
eno00650  Butanoate metabolism
eno01100  Metabolic pathways
eno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECENHK_09920
   00650 Butanoate metabolism
    ECENHK_09920
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECENHK_09920
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECENHK_09920
Enzymes [BR:eno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECENHK_09920
Amino acid related enzymes [BR:eno01007]
 Aminotransferase (transaminase)
  Class III
   ECENHK_09920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFP69857
LinkDB All DBs
Position
complement(2122264..2123535)
Genome map
AA seq 423 aa AA seqDB search
MSNQEFHQRRLSATPRGVGVMCNFFARTAENATLTDVEGNDYIDFAAGIAVLNTGHRHPE
MVAAVEKQLHQFTHTAYQIVPYESYVSLAEKLNELAPVQGPAKTAFFTTGAEAVENAIKI
ARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVYHVPYPSELHGITTQ
DAITAIERLFKADIEAKQVAAIIFEPIQGEGGFNVAPPELVAVIRRICDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGRAEIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDNESLCARACHLGDRLSATLEEIQGTFPALVAIRGRGSMIAAEFFD
PESREPSAAIAQAIQQKALAQGLLLLICGQYGNVIRFLYPLTIPDAQFTQALAILQQVMR
DKA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccaggaatttcatcagcgcagactttcggccaccccgcgcggcgtaggcgta
atgtgtaatttctttgcccgcacggcggagaatgctacgcttaccgacgtggaaggcaat
gactatattgatttcgccgccgggatcgcggtactgaataccggccatcgtcatcctgaa
atggtggccgccgtggaaaaacagctgcaccagttcacccacacggcctaccagattgtg
ccatatgaaagttacgtttccctggccgaaaaacttaacgagctggccccggtacagggc
ccggctaaaaccgcgttcttcacgacgggcgcggaagcggtggaaaatgccattaaaatc
gcccgggcccacaccggcaggcctggcgtgattgccttcgggggaggctttcacggccga
acctatatgaccatggcgttaaccggcaaggtcgcgccttataagctgggatttggcccc
ttccccgggtcggtttatcacgtaccctatccctccgagctgcacggcatcacgacgcag
gatgccatcacggcgatagagcgcctgttcaaagccgatattgaggcgaaacaggtagcg
gcgattatttttgaacccattcagggtgaaggcggattcaacgtcgcgccgccagagctg
gtggccgtcatccgccgcatctgtgatgagcacgggatcgtgatgattgccgatgaagtg
cagagcggtttcgcccgtaccggtaagctgtttgccatggaccactacgctgacaagcct
gacctgatgacgatggccaaaagcctggctggcggaatgccgctgtccggcgtggtgggc
cgcgctgagatcatggatgcaccagcccccggtggactcgggggaacctatgcaggcaat
ccgcttgcggtggccgccgcgcacgcggtgctgaatattatcgacaacgagtcactgtgc
gcgcgcgcctgtcacctgggcgatcgactgagcgctacgctggaggagattcagggtacc
ttccctgcgctagtggcgattagaggaagaggatcgatgattgcggcagagttttttgat
cccgagagccgtgaaccctcggccgccatcgcgcaggctatccagcaaaaggcgctcgcc
caaggcctgctgctgttgatctgcggccagtacggaaacgtgatccgcttcctttatccg
ttgaccataccggatgcccagttcacccaggcgctggcgatcctgcaacaggttatgcgt
gataaggcataa

DBGET integrated database retrieval system