KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0356Help
Entry
ECO103_0356       CDS       T01096                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00473  D-Alanine metabolism
eoh00550  Peptidoglycan biosynthesis
eoh01100  Metabolic pathways
eoh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ECO103_0356 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECO103_0356 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ECO103_0356 (ddlA)
Enzymes [BR:eoh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ECO103_0356 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:eoh01011]
 Precursor biosynthesis
  Amino acid ligase
   ECO103_0356 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: BAI29225
UniProt: C8U267
LinkDB All DBs
Position
complement(406249..407343)
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcgggtaggaatcgtttttggtggtaaatcagcggaacatgaagtgtct
ctgcaatcggcaaaaaacattgtcgatgccattgataaaagtcgcttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccagcaattatctgctaaat
gcagacgatcctgcccatattgcgttgcgcccttcggcgaccagccttgcgcaggtgcca
ggtaaacatgagcatcagcttatcgacgcgcaaaacggtcagccgttgccgacggtggat
gtcattttcccgattgtccacggtacgctgggcgaagatggttccttgcagggaatgctg
cgggtcgccaatttaccgtttgtaggttctgatgttctggcttcagcagcctgtatggat
aaagatgtcaccaaacgtctgctacgcgatgccgggctgaacattgcgccatttattacc
ctgacgcgcgctaatcgtcacaacatcagttttgccgaagtggagtctaaactggggtta
ccactgtttgtaaaaccggctaatcagggctcttctgttggtgtcagcaaagtaaccagt
gaagaacagtacgcaattgccgtcgatctggcgttcgagttcgatcataaagtgatcgtt
gagcaagggatcaaaggtcgtgagatcgaatgcgcagttctgggcaacgacaatccgcaa
gccagcacctgtggcgagatcgtactcaccagcgatttctatgcctacgacaccaagtac
attgacgaagatggcgcgaaagtggtagttccggcagccattgcaccagagatcaacgat
aagatccgggcgattgccgttcaggcttatcagacgttgggatgcgcaggcatggcgcgt
gtagacgtgtttttaaccccagagaacgaagtggtgatcaacgagatcaacacactgcct
ggcttcaccaacatcagtatgtatccgaagctgtggcaagccagcggtctgggttacacc
gatctgatcacacgtttgattgagctggcgctggagcgtcacgctgcggataacgcattg
aaaaccacaatgtaa

DBGET integrated database retrieval system