KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_4144Help
Entry
ECO103_4144       CDS       T01096                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase GlpD, aerobic, FAD/NAD(P)-binding
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECO103_4144 (glpD)
Enzymes [BR:eoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECO103_4144 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4223646..4225151
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggctccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcggattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcggactcgcgccacctctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcctggttaacgccaccggcccgtgggtgaaacagttcttcgacgaggggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaagcaggcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgaattttccatcatcggcaccaccgacgtagagtataaaggcgatccgaaa
gcggtgaagattgaagagagtgaaatcaactatctgctgaaagtgtataacgcgcacttt
aaaaaacagcttagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggctattacccgtgattacacccttgatatccatgat
gaaaacggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcagaacatgcgctggaaaaactgacgccgtattatcagggtattggcccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgcgacgattacgcagct
cgtctgcgccgtcgctatccattcctgactgaatcgctggcgcgtcattacgcacgcact
tacggcagcaacagcgagctgctgctcggcaatgcgggggcgataagcgacctcggggag
gatttcggtcatgagttctacgaagcggaactgaaatacctggtggatcacgaatgggtc
cgccgcaccgacgatgccctgtggcgtcgcacaaaacaaggcatgtggctgaatgcggat
caacaatctcgtgtgagtcagtggctggtggaatatacgcagcagaagttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system