KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0087Help
Entry
ECO111_0087       CDS       T01097                                 

Gene name
ftsI
Definition
(GenBank) transpeptidase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00550  Peptidoglycan biosynthesis
eoi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECO111_0087 (ftsI)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ECO111_0087 (ftsI)
Enzymes [BR:eoi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECO111_0087 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:eoi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ECO111_0087 (ftsI)
Chromosome [BR:eoi03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ECO111_0087 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: BAI34088
UniProt: C8UGV5
LinkDB All DBs
Structure
PDB: 

Jmol
Position
93168..94934
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMR
SLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTIT
DVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcgaaaacgcagaaaccaaaacgtcaggaagaacatgccaactttatc
agttggcgttttgcgttgttatgcggctgtattctcctggcgctggcttttctgctcgga
cgcgtagcgtggttacaagttatctccccggatatgctggtgaaagagggcgacatgcgt
tctcttcgcgttcagcaagtttccacctcccgcggcatgattactgaccgttctggtcgc
ccgttagcggtgagcgtgccggtaaaagcgatttgggctgacccgaaagaagtgcatgac
gctggcggtatcagcgtcggtgaccgctggaaggcgctggctaacgcgctcaatattccg
ctggatcagctttcagcccgcattaacgccaacccgaaagggcgctttatttatctggcg
cgtcaggtgaaccctgacatggcggactacatcaaaaaactgaaactgccggggattcat
ctgcgtgaagagtctcgccgttactatccgtccggcgaagtgactgctcacctcatcggc
tttactaacgtcgatagtcaagggattgagggcgttgagaagagtttcgataaatggctt
accgggcagccgggtgagcgcattgtgcgtaaagaccgctatggtcgcgtaattgaagat
atttcttctactgacagccaggcagcgcacaacctggcgctgagtattgatgaacgcctg
caggcgctggtttatcgcgaactgaacaacgcggtggcctttaacaaggctgaatctggt
agcgccgtgctggtggatgtcaacaccggtgaagtgctggcgatggctaacagcccgtca
tacaaccctaacaatctgagcggcacgccgaaagaggcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccgggctcaacggttaaaccgatggtggtaatgaccgcgttgcaacgt
ggcgtggtgcgggaaaactcggtactcaataccattccttatcgaattaacggccacgaa
atcaaagacgtggcacgctacagcgaattaaccctgaccggggtattacagaagtcgagt
aacgtcggtgtttccaagctggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttggactgggaaaagcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacggg
ctaatggtaacaccgttacagttagcgcgagtctacgcaactatcggcagctacggcatt
tatcgcccactgtcgattaccaaagttgaccccccggttcccggtgaacgtgtcttcccg
gaatccattgtccgcactgtggtgcatatgatggaaagcgtggcgctaccaggcggcggc
ggcgtgaaggcggcgattaaaggctatcgtatcgccattaaaaccggtaccgcgaaaaag
gtcgggccggacggtcgctacatcaataaatatattgcttataccgcaggcgttgcgcct
gcgagtcagccgcgcttcgcgctggttgttgttatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttcagcgccggtctttggtgccatcatgggcggcgtattgcgtacc
atgaacatcgagccggatgcgctgacaacgggcgataaaaatgaatttgtgattaatcaa
ggcgaggggacaggtggcagatcgtaa

DBGET integrated database retrieval system