KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_2375Help
Entry
ECO26_2375        CDS       T01098                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase SodC [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Brite
Enzymes [BR:eoj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECO26_2375 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: BAI25622
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(2303914..2304435)
Genome map
AA seq 173 aa AA seqDB search
MKRFSLAILALVVATGAQAASEKVEMNLVTSQGVGQSIGSVTITETDKGLEFSPDLKALP
PGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNN
DGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttttagtctggctattctggcgctggttgttgcaaccggcgcacaagctgcc
agtgaaaaagtcgagatgaacctcgtcacgtcgcaaggggtagggcagtcaattggtagc
gtcaccattactgaaaccgataaaggtctggagttttcgcccgatctgaaagcattaccc
cccggtgaacatggcttccatattcatgccaaaggaagctgccagccagccaccaaagat
ggcaaagccagcgccgcggaatccgcaggcgggcatcttgatccacaaaataccggtaaa
catgaagggccagaaggtgccgggcatttaggcgatctgcctgcactggtcgtcaataat
gacggcaaagctaccgatgccgtcatcgcgcctcgtctgaaatcactggatgaaatcaaa
gacaaagcgctgatggtccacgttggcggcgataatatgtccgatcaacctaaaccgctg
ggcggtggcggtgaacgctatgcctgtggtgtaattaagtaa

DBGET integrated database retrieval system