KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4713Help
Entry
G2583_4713        CDS       T01190                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Brite
Enzymes [BR:eok01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     G2583_4713 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-ProteinID: ADD59155
UniProt: D3QYA6
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4788406..4789032
Genome map
AA seq 208 aa AA seqDB search
MNMSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELI
TKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFE
KAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKF
QNRRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagctataccctgccatccctgccgtatgcttacgatgccctggaaccgcac
ttcgataagcagaccatggaaatccaccacaccaaacaccatcagacctacgtcaacaac
gccaacgcggcgttggaaagcctgccagaatttgccaacctgccggttgaagagttgatc
accaaactggaccagctgccagcagacaagaaaaccgtactgcgcaacaacgctggcggt
cacgctaaccacagcctgttctggaaaggtctgaaaaaaggcaccaccctgcagggtgac
ctgaaagcggctatcgaacgtgatttcggttccgtagataacttcaaagcagaatttgag
aaagcggcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaa
ctggcggtggtttctactgctaaccaggactccccgctgatgggtgaagctatttctggc
gcatccggcttcccgattctgggcctggatgtgtgggaacatgcttactacctgaaattc
cagaaccgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagca
gcggcacgtttcgcggcgaaaaaataa

DBGET integrated database retrieval system