KEGG   Exaiptasia pallida: 110239685Help
Entry
110239685         CDS       T05080                                 

Definition
(RefSeq) histone deacetylase 1-like
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
epa  Exaiptasia pallida
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:epa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    110239685
Enzymes [BR:epa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110239685
Chromosome [BR:epa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110239685
   HDAC complexes
    Sin3A-HDAC complex
     110239685
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110239685
  Chromatin remodeling factors
   NuRD complex
    110239685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MAYTSAGGKKRVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
VLEEMTKYHSDDYIKFLKTIRPDNMSEYTKQMQRFNVGEDCPVFDGLYEFCQLSTGGSLA
GAVKLNKTQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYNQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGRGKYYAVNFPLRDGIEDDSYQQ
IFQPIISKVMEIYQPNAVVLQCGADSLAGDRLGCFNLSLKGHAQCVEFVKKFGLPLLVLG
GGGYTIRNVARCWTYETSVALDADIANELPYNDYFEYFGPDFKLHISPSNMTNQNTPDYL
DKIKQRLFENLRMLPHAPGVQMQPIPEDALPDESDNEDEDDPEQRISIRASDKRIACEEE
FSDSEDEGDGRRDNQSAREGRSRKRNRAHPVENMVTNGSAENANGSDDVRSNNSTSNNQA
AELKPDSKPKPSSGSNTPKEGSPKTVGSTTAAESTADNSTVPQDANRKSPVEPEAQSSXP
AKDEQEAXEPMEVAESEPSKETSSETDPSQPEKTTETTQGETEPAPSESPAETPSKPSDQ
EESMEQ
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacacaagtgccggtggtaagaaaagagtttgctattattacgatggtgacatc
gggaactactattatggacagggacatcctatgaaacctcaccgtattcgcatgacccat
aacttattactcaactatggtctttacaggaaaatggaaatttatcgacctcacaaggct
gtcctggaagaaatgaccaaatatcattctgatgattatataaaattcctcaagacgatc
agacctgacaacatgtccgagtacacgaagcaaatgcagcgatttaatgttggtgaagat
tgcccggtgtttgatgggttgtatgaattctgtcagctttctacaggtggatctttagct
ggtgctgtcaagttaaacaagacacaaacggacatagcagtcaactgggctggtggattg
catcatgctaaaaaatcagaagcatcagggttctgctatgtgaatgatattgtgttagct
attttggaactgcttaagtataaccagcgtgttttatacatcgacattgatattcaccat
ggcgatggcgtggaggaagcattctacactactgacagagtcatgacagtttcatttcac
aaatatggtgaatatttcccagggacaggagatttaagggatataggtgctgggagagga
aagtactatgcagttaatttcccactaagggatggtattgaggatgactcctatcaacag
attttccaaccaatcatctctaaggtaatggaaatctaccagcccaatgcagtggtcttg
cagtgcggagctgattcattggctggtgacagactcggctgttttaacttgtcyctcaag
ggtcatgcacartgtgtggagtttgtcaagaagtttggtctgccattgttagtgcttggr
ggtggtggctatacaatmaggaatgtmgcaaggtgctggacctacgagacatctgttgcc
cttgatgctgatattgccaatgagctaccctataatgattactttgagtattttggacct
gatttcaagctgcacatcagtccatccaacatgactaaccagaacacccctgactacttg
gataagatcaagcaacgactgtttgaaaatctgcgaatgttgccacatgcgcctggagtg
caaatgcaacctatcccagaagatgcattaccagatgaaagtgacaatgaagatgaagat
gatcctgaacaaagaataagtatacgtgcatctgayaarcgaattgcttgygaggaagaa
ttttctgattctgaagacgaaggtgatggacgacgagacaaccagtcagckcgtgaaggt
agatcacggaaacgaaatcgtgcacacccagtagagaacatggttactaatggaagtgca
gagaatgccaatggaagtgatgatgtcagatctaataatagcacatctaataaccaagca
gctgagttaaaacctgactctaaacccaaaccatctagtggatctaatacacctaaggaa
ggatcacccaagacagtaggaagtactactgctgctgagagtactgctgataactctact
gtacctcaagatgcaaaccgcaaaagtcctgttgagccagaagcacagagttctgygcca
gccaaggatgaacaagaagccaktgaaccaatggaggtcgctgaatctgagccatccaag
gaaacaagtagtgagactgatccctcacaaccagagaaaactacagaaaccactcaaggt
gaaactgagcctgcacctagtgaatctccagcagaaactccttcaaaaccatctgatcaa
gaagaaagtatggaacaatga

DBGET integrated database retrieval system