KEGG   Exaiptasia pallida: 110250626Help
Entry
110250626         CDS       T05080                                 

Definition
(RefSeq) uncharacterized protein LOC110250626 isoform X1
  KO
K02358  
elongation factor Tu
Organism
epa  Exaiptasia pallida
Brite
Translation factors [BR:epa03012]
 Eukaryotic Type
  Elongation factors
   110250626
 Prokaryotic Type
   110250626
Mitochondrial biogenesis [BR:epa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    110250626
Exosome [BR:epa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110250626
  Exosomal proteins of breast cancer cells
   110250626
  Exosomal proteins of colorectal cancer cells
   110250626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MLSLRLSGIKCQQLLARAAQSTRTIVSISHQRNINRTGIRVLSTPRLLVRCYAAEPSKKT
FXRBKPHVNIGTIGHVDHGKTTLTAAITKILAEKGSANFKSYGDIDNAPEERARGITINT
AHVEYETDKRHYGHVDCPGHADYIKNMITGAAQMDGAILVVAGTDGQMPQTREHLLLANQ
VGVKNIVVFVNKADVIDDPELLELVEVEMREVLTEYNYDGDNTPIIIGSALCALEEKXPD
MGINAIMKLLDAIDTHIPTPDRQLDKPFLLPIEDVFSISGRGTVVTGRIERGVVKTGDQV
EIVGHKSKIKTTVTGIEMFHKLLDXGEAGDNLGALIRGVKREDVRRGTVLCAPGSVSSHT
KFTAQVYILKKEEGGRHTPFVTNYSPQMFLRTGDVPATITLPEGSEFVMPGDNAQLTIKL
MFDMPLETGLRFTLREGGRTVGTGIVTEILE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgctttccttgaggttatcggggataaaatgtcagcaattactcgctagagcagctcaa
agcactaggactatagtgtcaatatctcaccaaagaaatatcaacagaactggaataaga
gttctctcaactcctagattattagtaagatgttacgctgctgaaccttcaaaaaaaacc
tttrcaagarataaaccacatgttaacattggaacrattggacatgttgaccatgggaaa
actacactaactgcagccataacaaaaattttggctgagaagggatcagcaaacttcaaa
tcatatggagatattgataatgccccggaggaaagagcacgtggaataaccatcaatact
gcgcatgtygagtatgagactgataaacgtcattatggacatgtagattgccctggacat
gctgactatatcaagaacatgatcacaggagcagcgcaaatggatggagctattttggta
gttgctggaactgatggtcaaatgcctcaaaccagggaacacttattactagcaaaccag
gttggggttaaaaatattgtcgtttttgttaacaaagctgatgtaattgatgatccagag
ctattagaattggttgaagttgaaatgcgtgaggttttaactgagtacaattatgatggt
gacaatactcctataatcattggatcagctctctgtgctctagaagaaaaaarccctgac
atgggaatcaatgcaataatgaaactccttgatgccattgatacccacatcccaacccct
gacagacaacttgacaagccatttctgcttcccattgaagacgttttctcaatttctgga
cgaggaactgtagtaactggaagaattgaacgaggtgttgtaaagacaggtgatcaggtg
gagattgttggacacaaatccaagataaagacaacagttacaggtattgagatgtttcac
aaacttcttgatcraggagaggcaggtgataayctaggagctttaattcgcggtgttaaa
agagaagatgttcgtcgtggaacagtcctttgcgctcctggttcagtcagttctcatact
aaatttactgctcaagtgtatatactgaagaaagaagaaggtggtcgtcacactcctttc
gttactaactactcccctcagatgtttctccgtactggtgatgtacctgccaccatcacc
ctccccgaggggagtgaatttgttatgcctggcgataatgcccagttgaccatcaagttg
atgtttgacatgccgttagagaccgggcttcgattcacgctaagagagggaggcaggacg
gtggggactggtatagtaactgaaatcttagaatga

DBGET integrated database retrieval system