KEGG   Equus przewalskii (Przewalski's horse): 103546792Help
Entry
103546792         CDS       T04644                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz05034  Alcoholism
epz05165  Human papillomavirus infection
epz05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:epz00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    103546792 (HDAC7)
  Substance dependence
   05034 Alcoholism
    103546792 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    103546792 (HDAC7)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103546792 (HDAC7)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103546792 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103546792
NCBI-ProteinID: XP_008511838
LinkDB All DBs
Position
Un
AA seq 827 aa AA seqDB search
MVNFPSQGLELLEQGSEGCPRPRADTPGPQPQPMDLRVGQRPTVEPPPEPTLLALQHPPR
LHHHLFLTGLQPQRSAEPMRVGQQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQ
AALERTVHPNSPSIPYRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPN
LKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHG
PGPGLGTEADGDHRTHLTLGPRGPVLGSPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPS
APHAPLLTVPGLGPLPFHFAQSFLTTERLSGSGLHRPLSRTRSEPLPPSATAPPPLGPLQ
PRLERLKPHIQLTKRPAKSEKPRLRQIPSAEDLETDGGGVGPVGDDGLEHRESSHGHHEA
RGPVPLQQHQQVFLWDHQRLAGRLPRGSTGDSVLLPLAQGSHRPLSRAQSPPAAPASLPT
PEPASQARVLPSSEPPARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQ
ERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKXXXXLYGANPLSRLKLDN
GKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGF
AVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKILIVDWDVHHGNGTQQTFYQD
PSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIV
VMPVAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCKEGPAQGVV
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacttcccatctcagggattggagttactggagcaggggagtgagggctgcccc
aggccccgtgcagacacgccaggccctcagccccagcccatggacctgcgggtgggccag
cggcccacggtggagcccccaccggagcccacgctgctggccctgcagcaccccccgcgt
ctgcaccaccacctcttcctgacaggcctgcagccgcagcgctcggcggagcccatgagg
gtggggcagcaggagcaggagctgcggcagcttctccataaggacaagagcaagcgaagt
gccgtggccagcagtgtggtcaagcagaagctggcggaggtgattttgaagaaacagcag
gcagccttagagagaacagtccatcccaatagccccagcatcccctacagaactcttgag
cccttggagacggaaggtgccgcccgctccatgctcagcagctttctgcctcccgttccc
agcctgcccagtgaccccccagaacacttccctctgcgtaagacagtctcggagcccaac
ctgaagctgcgctacaagcccaagaagtcactggagcggaggaagaatccgctgctcaga
aaggagagcgccccgcccagtctccggcgccggcctgcagagaccctcggtgactcctcc
ccgagtagcagcagcacgccagcctcggggtgcagctcccccaatgacagcgagcatggc
cccggccccggcctgggcacagaggcggatggtgaccacaggacccatctaactctgggc
cctcgggggccagtcctggggagcccccatgctcccctcttcctgccccatggcctggag
cctgaggctgggggccccttgccctctcgcctgcagcccattctcctcctggatccctca
gcccctcacgcacccctgctgactgtgcccgggcttgggcccctgcccttccactttgcc
cagtccttcctgaccaccgaacggctctccgggtcaggcctccacaggccgctgagccgg
acccgctcagagcccctgcccccaagcgccaccgcccccccaccgctgggccccctgcag
ccccgcctggagcgactcaaacctcacatccagctgaccaagaggccagccaagagtgag
aagccccgactgcggcagattccctcggctgaggacctagagacggatggggggggagtg
gggccggtgggggatgacggcctggaacacagggagtcgagccatgggcaccatgaggcc
aggggccctgttcctctccagcagcaccaacaggtgttcctctgggaccatcagcgactg
gctgggcggctcccccggggcagcactggggactctgtgctgcttcccctggcccagggc
agtcaccggcccctgtccagggctcagtcgcccccagctgcgcctgcctcactgccaacc
ccagagcctgccagccaggcccgcgtcctgcccagctcagagccccccgccaggaccctg
cccttcaccacagggctggtctatgactccgtaatgctgaagcaccagtgttcctgcgga
gacaacagcaggcacccagagcatgctggccgcatccagagcatctggtcccggctgcag
gagcgggggctgcggagccagtgtgagtgtctccggggccggaaggcctccctggaggag
ctgcagtctgtgcattccgagcggcacgtgctcctctatggcaccaacccgctcagccgc
ctcaaannnnnnnnnnncctctatggcgccaacccgctcagccgcctcaaactggacaac
gggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgtggtggggtt
ggggtggatactgacaccatctggaatgagctgcactcctccaatgcagcccgttgggcc
gccggcagcgtcactgaccttgccttcaaagtggcttcccgcgaactaaagaacggtttt
gctgtggttcggcctccaggacaccatgcagaccattccactgccatgggcttctgcttc
ttcaactcagtggccatcgcctgccgacagctgcaacaacagggcaaggccagcaagatc
ctcattgtggactgggatgttcaccacggcaacggcacccagcaaaccttctaccaggac
cccagcgtgctctacatctccctgcatcgccatgacgacggcaacttcttcccaggcagt
ggggctgtggatgaggtgggagctggcagcggtgagggcttcaatgtcaacgtggcctgg
gccggaggtctggaccccccaatgggggatcctgagtacctggccgccttcaggatcgtc
gtgatgcctgttgcccgagagttctctccagacctggtcctggtgtcagctgggtttgat
gctgccgagggtcaccccgccccgctgggtggctaccatgtttccgccaaatgtaaggag
ggcccagcccagggagtggtgtag

DBGET integrated database retrieval system