KEGG   Equus przewalskii (Przewalski's horse): 103548807Help
Entry
103548807         CDS       T04644                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:epz00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103548807
Enzymes [BR:epz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103548807
Chromosome [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103548807
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1719 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAISSGSLVSKREVELENNTKEEEDVRKWNRERNIGT
GKDDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKAGDVAAIECQSEESIHLHSQGENNPLSKKLSP
VHSEMTDYLNATSSTLVGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
ATGTTAGLVSKDLIRKASVGSVAGIIHKDLIKKPAISTAVGLVTKDPGKKPVFNAAVGLV
SKDSVKKLGTGTTAVFINKDLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVNKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVTNSTMGLVNKDIGKKLVSCPMAGLVSKD
AINLKAEALLPTQEPLKASCSTNINSLESQELSESLKDNATSKTFEKNVIRQSKESLLEK
FSVRKEIINLEKEIFNEGTCIQQDSFSSSERGSYETSKHEKQPPVYCTSPDFQMGGASDA
SAAKSPFSAVGESNLPSPSPTVSVNPLTRSSPETSSQLAPNPLLLSPTTELMEEISESLG
KNQFSSESTHLNIGHRSVGHSMNIECKGIDKELSDSKTTHIDIPRISSSLGKKPSLSSES
SIHTITPSVVNFTSLFSNKPFLKLGAVTASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSACRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPSSFVDHDFLKRRLP
KLSKSTTPSLALLTDSEKPSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDHHRSSSDFFESEDQLQDPDDLDDSHRPTVCSMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPASLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFIADLEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDAGSSRSVLESLKRYRFGKDTVGERYKHKEKHRCHMSCPHLSPSKNLINREEQWVHRE
PSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSDPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRPHRKETLPSSERAVQTLTGSQPTSEKSSQRPSESTNS
SPTRKRSLSESTSSTGKCSLFYETLKIIFHLLLVNRLTI
NT seq 5160 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgattccgaaggattttcaaga
aagagtccctctgccatcagtagtggttcactggtcagcaagagagaagtagagctagaa
aacaacacaaaggaggaagaggacgttcgcaagtggaatcgagaaagaaacattggaacg
gggaaagatgatggtttgactgatgcacagcaacagttttcagtgaaagaaacaaacttt
tcagagggaaatttaaaattgaaaattggccttcaggctaagagaactaaaaaacctccg
aagaacttggagaactatgtatgtcgacctgccataaaaacaactattaagcacccaagg
aaagcacttaaaagtgggaagatgacagatgaaaagaatgaacactgtccttcaaaacga
gatccttcaaagttgtacaagaaagcaggtgatgttgcagccattgaatgccaatctgaa
gaaagcatccatcttcattcacagggagaaaacaatcctttgtctaagaagctttctcca
gtacactcagaaatgacagattaccttaatgcaacatcatctactcttgttggtagccgg
gatcctgatttaaaggacagagcattacttaatggaggaacgagtgtaacagaaaagttg
gcacagctcattgcaacttgtcctccctccaagtcttccaagacaaaaccgaagaagtta
gcaactggcactactgcgggattggttagtaaagatttgatcaggaaagcaagcgttggc
tctgtagctggaataatacataaggacttaattaaaaaaccagctatcagcacagcagtt
ggattggtaactaaagatcctgggaaaaagccagtgtttaatgcagcagtaggattggtc
agtaaggactctgtgaaaaaactaggaactggcactacagcggtattcattaataaagac
ttaggcaaaaagccagggactatcactacagtaggactgctgagcaaggattcaggaaag
aagctaggaattggtattgttccaggtttagtgaataaggaatctggaaagaagttagga
cttggcactgttgttggactggttaataaagacttgggaaagaaactgggttctactgtt
ggcctagtggctaaggactgtgcaaagaagattgtaacaaattcaacaatgggattagtt
aataaggacattggaaagaaactagtgagttgtcctatggcaggactggtcagtaaagat
gccataaaccttaaagccgaagcactgctccccactcaggaaccacttaaggcttcttgt
agtacaaacatcaatagtcttgaaagtcaggaactgtctgaatccctgaaagacaatgcc
accagcaaaacttttgagaagaatgtcatacggcagagtaaagaaagcctattggaaaag
ttctcagttcgaaaagaaatcattaatttggagaaagaaatatttaatgaaggaacttgt
attcagcaagacagtttctcgtccagtgaaagggggtcttatgaaacctcaaagcatgaa
aagcaacctcccgtatattgcacttctccggactttcaaatgggaggtgcttctgatgca
tctgcagctaaatccccttttagtgcagtaggagaaagcaatctcccttccccgtcacct
actgtgtctgttaatcctttaaccagaagttcccctgaaacttcttcacagttggctcct
aatccattacttttaagtcctaccacagaactgatggaagaaatttctgaatctcttgga
aagaaccagttttcttctgaaagtacccacttgaacattggtcataggtccgtgggtcat
agcatgaatattgaatgtaaagggattgataaagagctaagtgattcaaaaactacacat
atagatattccaagaataagctcttctctgggaaaaaagccaagtttgagttctgaatcc
agtattcatacaattaccccttcagttgttaacttcactagtttatttagtaataagccc
tttctaaaacttggtgcagtaactgcatccgacaaacactgccaagttgctgaaagccta
agcactagtttgcagtccaagccattaaaaaaaaggaaaggaagaaaacctcggtggact
aaagtggtggcaagaagtgcatgccggtctccaaaagggctagaattagaaagatcagag
ctttttaaaaatgtttcatgtagctcactgtcaaatagtaattctgagccagccaaattt
atgaaaaacattggaccatcttcatttgtagatcatgacttccttaaacgccgattgcca
aagctgagcaaatccacaactccatctcttgctctcttaactgatagtgaaaaaccatct
cataaatcttttgctactcacaaactatcctccagtatgtgtgtctctagtgaccttttg
tctgatatttataagcccaaaagaggaagacctaaatccaaggagatgcctcaattggaa
ggtccacctaaaaggactttaaaaatccctgcctctaaagttttttctttgcagtctaag
gaagaacaagaacccccaattttacagccagaaattgaaattccttccttcaaacaaagt
ctgtctgtgtctccttttccaaaaaagagaggcagacctaagaggcaaatgaggtctcca
gtcaagatgaagccacctgtactatcagtggctccgtttgttgccaccgaaagtccaagc
aagctggagtctgaaagtgatcaccatagaagtagcagtgatttctttgagagtgaggat
caacttcaggatccagatgatctagatgacagtcataggccaactgtctgtagtatgagt
gaccttgagatggaaccagataaaaaaattaccaagagaaacaatggacaattaatgaaa
acaattatccgcaaaataaataaaatgaagactttaaaaagaaagaaactgttgaatcag
attctttcaagctctgtagaatcaagtaataaagggaaagtgcaatccaaactccataat
acagtgtcaagtcttgccgccacatttggctctaaattgggccaacagataaatgtcagc
aagaaaggaaccatttacataggaaaaaggaggggtcgaaaaccaaaaactgtcttaaat
ggcattctttctggtagccctgccagccttgctgttcttgagcaaacagctcagcaggca
gctgggtcagcattaggacagatccttccccctttactgccttcatctgctagtagttct
gagattcttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccct
gtaagtagtgatgcaggctttgttgaacccagttcagtgccgtatttgcatttacactcc
agacagggcagtatgattcagactcttgcaatgaagaaggcctcaaaggggaggaggcga
ttatctcctcctactttgttgccaaattcgccttctcacttgagtgaactcacatctctg
aaagaagctactccttctcccattagtgagtctcatagtgatgagaccattcccagtgat
agtggaattggaacagataataatagcacatcagacagggcagagaaattttgtgggcaa
aaaaagaggcggcattcttttgagcatgtttctctgattccccctgaaacctctacagtc
ctaagcagtcttaaagaaaaacataaacataaatgtaagcgcagaaatcatgattacctc
agctatgacaagatgaaaaggcagaaacgaaaacggaaaaagaaatatccacaactccga
aatagacaggatccagacttcattgcagatctggaggaattaataagtcgtctcagtgaa
attcgaattacccatcgaagtcatcattttatcccccgagaccttctgccaactattttt
cgaatcaactttaatagtttctatacacatccttctttccccttagaccctttgcactac
attcgaaaacctgacttaaaaaagaagagagggagaccccctaagatgagggaggcaatg
gctgaaatgccttttatgcatagccttagttttcctctttctagtactggattctatccg
tcttatggcatgccttactctccctcgccccttacagctgctcccataggattaggttac
tatggaaggtatcctcccactctttatccacctcctccatctccttctttcaccactcca
cttccacctccttcctatatgcatgctggtcatttacttctcaatcccacgaaataccat
aagaaaaagcataagctacttcggcaggaggcctttcttacaaccagcaggactcccctt
ctttccatgagtacctaccctagtgtccctcctgagatggcctacggttggatggtggag
cacaaacacaggcaccgtcacaaacacagagaacaccgttcttctgagcaaccccaggtt
tccatggacgctggctcttccagatccgtcctggagtctttgaagcgctatcgatttgga
aaggatactgttggagagcgatataaacataaggaaaagcaccgttgtcatatgtcttgc
cctcatctctctccttcaaaaaacttaataaacagagaagaacagtgggtccaccgagag
ccttcagagtctagtccattggccttgggattgcagacacctttacagattgactgttca
gaaagttctccaagtttatcccttggaggattcactcccaactctgatccagccagcagt
gatgaacatacaaaccttttcacaagtgcaataggcagctgcagagtttcaaaccctaac
tccagtggccggaagaaattaactgacagccctggactgttttctgcacaggacacttca
ctaaatcggcctcacagaaaggagacgctgccttccagcgaaagggcagtacagaccttg
acaggttcccaaccaacctcagagaagtcttcccagcgaccatcagagagcacaaacagt
agccctaccaggaagaggtctttatctgagagtacatcttcaacaggtaagtgctctttg
ttttatgagactttgaagataattttccatctgttacttgtgaacagacttacaatataa

DBGET integrated database retrieval system