KEGG   Equus przewalskii (Przewalski's horse): 103559241Help
Entry
103559241         CDS       T04644                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:epz00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    103559241
   04614 Renin-angiotensin system
    103559241
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103559241
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    103559241
Enzymes [BR:epz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103559241
Peptidases [BR:epz01002]
 Metallo Peptidases
  Family M2
   103559241
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103559241
CD molecules [BR:epz04090]
 Proteins
  103559241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MGQGRAAPGLPSLLFLMLCCGYPLLVPSQEATSQVTINQGTTSQATISSQTTTHQTTTSQ
GTASRQTTQSPKLVSDEAEASKFVEEYDRRSQVVWNEYAEANWNYNVNITTEASKILLQQ
NIQMANHTVKYGTWARQFDVTNFQNTTMKRMIKKIQDLERAALPVKELQEYNKILLDMET
TYSVASVCLANGTCLQLEPDLTNLMATSRKYEELLWAWQGWRDNVGRSILPFFPKYVELF
NKAARLNGYVDAGDSWRSMYEMPSLEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHV
NLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPKMDATEAMIKQGWTPRRMFEEADNFFT
SLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTAVNMEDLVVAHHE
IGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVSTPKHLYNINLLSSEGGGYEQDI
NFLMKMALDKIAFIPFSYLVDQWRWRVFDKSITKENYNQEWWSLRLKYQGLCPPVARSQG
DFDPGAKFHIPSSVPYIRYFVSFVIQFQFHEALCQAAGHKGPLHKCDIYQSKEAGKRLAD
AMKLGFSKPWPEAMKLITGQPNMSASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPN
SARSEASFLGTGRVNFLGLNLEEQQARVGQWMLLFLGVALLVATLGLTQRLFSIRQYSLR
QPHRGPQFCSEVELRRS
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaggtcgggctgctccaggactgcccagcctcctcttcctcatgctttgctgt
gggtacccactactggtccccagccaggaggccaccagccaggtgacgatcaaccaggga
acaaccagccaggcaacaatcagcagccagacaacaacccatcagacaaccaccagccag
ggaacagccagtcgccagacaacccagagcccaaagctggtgagtgatgaggctgaggcc
agcaagtttgtggaggaatatgaccggagatcccaagtggtgtggaacgaatatgccgag
gccaactggaactacaacgttaacatcaccacagaggccagcaagatcctgctgcagcag
aacatacagatggcaaaccacactgtcaagtatggcacctgggccaggcagtttgatgtg
accaacttccagaataccaccatgaagcggatgataaagaagattcaggacctagagcgg
gcagcgctgcctgtcaaggagctgcaggagtacaacaagatcctgctggacatggaaact
acttacagcgtggcctctgtgtgcctcgccaatggcacttgtctacagctagagcctgat
ctgacgaatctgatggccacatcccggaaatatgaagaactgttgtgggcatggcagggc
tggcgagacaatgtggggaggtccatcctccctttttttccaaaatacgtggagctcttc
aacaaggctgcccggctcaatggctatgtagacgcaggggactcgtggagatctatgtac
gagatgccgtccctggagcaagacctggagcagctctaccaggagctgcagccgctctac
ctgaacctgcacgcctacgtgcgccgggccctgcaccgccactacgggccacaacacgtc
aacctggagggccccattccagctcatctcctggggaacatgtgggcgcagacctggtcc
aacatctatgacttggtggtgcctttcccttcagcccccaagatggatgccacagaagcc
atgataaagcagggctggacacccagaaggatgtttgaggaagcggacaatttcttcacc
tccctgggactgctgcctgtgccccctgagttctggaacaagtccatgctagagaagcca
actgatggacgggaggtggtatgccatgcctctgcctgggacttctacaatggcaaagac
ttcaggatcaagcagtgcactgctgtgaatatggaggacctggtggtggctcaccacgaa
ataggccacatacagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggt
gccaaccctggctttcatgaggccattggggacgtgctggcactctcagtgtctaccccc
aagcacctatacaacatcaacctgctgagtagcgagggtggtggctacgagcaagatatc
aactttctgatgaagatggcactcgacaagattgcctttatcccgttcagctaccttgtt
gaccagtggcgctggagagtgtttgacaaaagcattactaaggagaattacaaccaggaa
tggtggagcctcaggctgaagtaccagggcctctgccctccagtagccaggtctcaaggt
gactttgacccaggggccaaattccacattccttcaagtgtgccttatatcaggtacttt
gtcagctttgtcatccagttccaattccacgaggcactgtgtcaggcagctggccacaag
ggccccctacacaagtgtgacatctaccagtccaaggaggcagggaagcgcctggcggac
gccatgaagctgggcttcagtaagccatggcccgaagccatgaagctaatcacgggccag
cccaacatgtcagcctcagccatgatgaactacttcaagccgctgctggactggctcctc
actgagaacgggcggcacggggagaagctgggatggccacagtacaactggacaccaaac
tctgctcgctcggaagcctccttcctgggcaccggccgtgtcaacttcctgggcttgaac
ctggaggagcagcaggcccgtgtgggccagtggatgctgctcttcctgggcgtcgccctg
ctggtggccaccttgggtctcacccagcggctcttcagcatccgccagtacagcctccgc
cagcctcaccgtgggccccagttctgctccgaggtggagctgagacgctcctga

DBGET integrated database retrieval system