KEGG   Eubacterium rectale ATCC 33656: EUBREC_2937Help
Entry
EUBREC_2937       CDS       T00909                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00473  D-Alanine metabolism
ere00550  Peptidoglycan biosynthesis
ere01100  Metabolic pathways
ere01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EUBREC_2937
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EUBREC_2937
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EUBREC_2937
Enzymes [BR:ere01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EUBREC_2937
Peptidoglycan biosynthesis and degradation proteins [BR:ere01011]
 Precursor biosynthesis
  Amino acid ligase
   EUBREC_2937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK GARS_A ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ACR76666
UniProt: C4ZI29
LinkDB All DBs
Position
complement(2820759..2821868)
Genome map
AA seq 369 aa AA seqDB search
MCLIKPKHDNSIKEKRTKMNIVVLAGGLSTERDVSFKTGSMVAKALKENGHKVILLDVFM
GYSDREEDLTGIFDRADEISVQVSDIPTEAPDLAKVKASRKDQSPCFFGPNVIKMCQMAD
IVFMALHGENGENGKIQAAFDLFGVKYTGSDYLSSAIAMNKETSKQFFLANGIPTPKGIS
MTRATRQDDITKLDLTLPCVVKPCCGGSSIGVTIVRDAAEFKAALDDAFKWENELVIEEF
VQGREFSVGVIEGKALPIIEIAPKEGFYDYKNKYKAGSTVETCPAELPEQVTKDMQHYAE
EVARVIGLDTYSRSDFLLNDKNEMFCLEANTLPGMTPTSLLPQEAAVIGMSFNQLCEHLI
DISLKKYEV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtttaattaaaccaaagcatgataattcaatcaaagaaaagaggacaaaaatgaac
atcgtagtacttgccggagggctcagcacagagagagatgtttccttcaagacaggaagc
atggtagctaaggcgctcaaagagaacggccacaaagttatattattggatgtatttatg
ggatatagtgacagggaggaggacctgacaggtatatttgaccgcgcggacgagataagc
gtgcaggtcagcgatattccgacagaggcacctgacctcgcaaaggtaaaggcttccaga
aaggaccagtcaccttgcttcttcggaccaaatgtcatcaagatgtgtcagatggcagac
attgttttcatggcactccacggagaaaacggagagaacggaaagatacaggcagcattt
gacctcttcggtgtcaaatatacaggcagcgattatttaagctcagccatcgccatgaac
aaggagacatcaaagcagttcttccttgcaaacggtatccctactccaaagggcatttcc
atgaccagagcgaccagacaggacgatatcacaaagcttgacctgacacttccatgcgtg
gtaaagccatgctgcggcggttcaagcatcggtgtcactatcgttagggatgcggcagag
ttcaaggcggcacttgacgatgccttcaagtgggaaaatgagctggttatcgaggaattt
gtacagggcagggagttctctgtcggcgttatcgagggaaaggctcttcctattatagag
attgcaccgaaggagggcttctacgattataagaataaatacaaggcgggcagtacagta
gagacatgtccggccgagcttcctgagcaggtgacaaaggatatgcagcactatgcagag
gaggttgcgcgtgttatcgggcttgacacatattcacgctcagactttttgctcaacgac
aaaaatgagatgttctgcctcgaggcaaacacactgccgggcatgactccgaccagtctt
ctgccacaggaggcagcggttatcggtatgagctttaatcagctctgtgagcatctgatt
gacatatctttgaaaaaatatgaggtgtag

DBGET integrated database retrieval system