KEGG   Encephalitozoon romaleae: EROM_031240Help
Entry
EROM_031240       CDS       T03458                                 

Definition
(RefSeq) histone deacetylase 1
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ero  Encephalitozoon romaleae
Brite
Enzymes [BR:ero01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     EROM_031240
Chromosome [BR:ero03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     EROM_031240
   HDAC complexes
    Sin3A-HDAC complex
     EROM_031240
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    EROM_031240
  Chromatin remodeling factors
   NuRD complex
    EROM_031240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
III
AA seq 415 aa AA seqDB search
MNNKRVVYFYDPEIGTFSYAMGHPMKPLRVKMTHTLLVGYELYKYMDVLRPFQASYENLT
NFHAVDYINFLSSVSSENMEEMIKDLHKFNIRDDCPVFPGLYDYCKLTSGGSIYAAQKIN
SGKYDVAINWAGGLHHAKRSEASGFCYVNDIVLGILELLKYNKRVLYIDIDVHHGDGVEE
AFYTTDRVMTVSFHKYGDYFPGTGMVTDIGLAKGKGYSVNVPLRDGIDDESYFSIFKPVV
SKVIEVYRPDAIVLQSGADSLSGDKLGCFNLSHLGHSRCIKFVQSFNIPLILLGGGGYTI
GNVSKAWAYGTSVVLDVEIPREIPYNEYFDYYAPTYKIDVPTSNMKNQNTKESLEDIVAK
VHENLRGVSHAPSVQMSTIPPSFISDESDDEEISKKKIGEDSDDYKAFSGSREEL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaagagagtagtctacttctatgaccctgaaattggaacctttagttatgca
atgggacatcccatgaaacctctgagagtaaagatgacccatactctcttggtcgggtat
gagctttacaaatacatggatgttctcagaccatttcaggcgtcatacgagaatctaaca
aactttcatgcagtagattatataaactttttgtccagtgtctctagtgaaaacatggag
gaaatgattaaggaccttcacaagttcaacattagagatgattgccctgtgtttccaggg
ctttatgactactgcaaactcaccagtggggggagtatttatgcagcacagaagattaac
tctggaaaatatgatgttgcaattaattgggctggagggttacatcatgctaagagaagt
gaagcctcggggttttgctatgtgaatgacatagtcctaggaattcttgagctcctgaaa
tataacaaaagggttctatacatagatatagatgttcatcacggggatggggttgaagag
gcattctataccactgacagggtgatgactgtctccttccataagtacggagattatttt
ccgggaactggaatggtcacagacatcgggctggcgaaaggtaagggatattcagttaat
gttccattgagagatgggattgatgatgaaagttatttcagtatattcaagcccgttgtc
agtaaagttatagaggtatataggccagatgcgattgtattacaatctggggctgattcg
ctctcgggggataagctagggtgttttaatctatcccatctaggacactccaggtgtatt
aaatttgtgcagagcttcaatattccccttattcttcttggaggagggggatacacaatt
ggaaatgtttcaaaggcatgggcctatggaacaagtgttgttctggatgtcgagatccct
agagagattccttacaacgagtattttgattactatgcaccaacatacaaaatagatgtt
cctacatcaaatatgaaaaaccagaacacaaaagaaagcttggaagatattgtggcaaaa
gtgcacgagaacctaaggggtgtttcccatgctccttcggtacaaatgtcaactatcccg
ccctcttttattagtgatgagagtgatgatgaagaaatttcaaagaagaaaataggagaa
gactcagatgactacaaagcattctctggttcaagggaagaattgtaa

DBGET integrated database retrieval system