KEGG   Erythrobacter sp. s21-N3: CP97_13800Help
Entry
CP97_13800        CDS       T03997                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ery  Erythrobacter sp. s21-N3
Brite
Enzymes [BR:ery01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     CP97_13800
Lipid biosynthesis proteins [BR:ery01004]
 Acyl-CoA synthetase
  Unknown
   CP97_13800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2819353..2821080
Genome map
AA seq 575 aa AA seqDB search
MTELTPTPNDCPLPRRRSDFITFNEAIDYAARSEKGLNFYDPRGTLERVYPYASMREDAL
ANARRLSAMGIGKDDRVALIAETSPEFTAMFCACVYAGAWPVPLPLPTTFGGKDSYIEQL
GVQLASSDPKLLVYPAEIGEMASAAAARQGCTGMDWDAFAAQEAPDADLPEADPDDICYL
QYSSGSTRFPTGVAVTHRALLHNLYGHATSMHIGEGDRGVSWLPFYHDMGLVGCFLSMIG
NQVSADYLKTEHFARRPLAWLDLISRNPGNSLSYSPTFGYDICARRISSQSQVSDRFDLS
RWRLAGNGADMIRPDVMQQFVNAFADAGFKASAFTPSYGLAEATLAVTVMPPGEGIRVEL
VEEERLSGTLRDLSRPARYRAIVNCGKPLPDMDVEIRGENDAVKGDHQIGKVWCRGPSVM
HSYFRDEAATGDCLVDGWLDTGDMGYMADGYLFIVGRAKDMIIINGKNHWPQDIEWAVEQ
LPGFNHGDIAAFSVETENGEEAPAVLVHCRVSDPDERIRLRDQIADKVRAVTGMSCVVEL
VPPRTLPRTSSGKLSRAKAKKLYLSGEISPLDLAA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcacccctaccccgaatgattgccccctgccgcgtcgcaggtctgatttt
atcaccttcaacgaggcgatagattatgccgcgcgcagtgaaaagggcctcaatttctac
gatccgcgcggaacgctggaacgtgtgtatccctatgccagcatgcgcgaagatgcgctg
gccaacgcccgccgcctgtccgcaatgggcattggaaaagatgacagggttgcactgata
gcggaaaccagccccgaatttaccgccatgttctgcgcctgcgtctatgcgggtgcatgg
ccggtgccgctgccgctgcccaccacctttggtggcaaggacagttatattgaacagctg
ggcgtgcaattggccagcagcgatcccaagctgctcgtctatcctgccgaaatcggtgaa
atggccagtgcagctgccgccagacagggctgcaccggaatggattgggatgcatttgcc
gcgcaggaagcacccgatgccgatctgccggaggccgatcccgatgacatctgctatctg
caatattccagcggctccacccgtttcccgaccggcgttgctgttacccaccgggccttg
ctgcataatctttacggccatgccacgtcgatgcacatcggagagggcgatcgcggggtg
agctggctgcccttctatcacgatatggggctggtcggctgcttcctgtccatgatcggc
aatcaggtcagcgccgattatctcaagacagaacatttcgcccgccgcccgctggcgtgg
cttgacctcatcagccgcaatcccggcaattcattgagctactcgcccaccttcggctat
gacatttgcgcccgccgcatttccagccagagccaggtatcggaccgtttcgatctgtcg
cgctggcgattggcaggcaatggcgcggatatgatccggcctgacgtgatgcagcaattc
gtcaacgcctttgccgatgcgggtttcaaggcgagcgccttcacaccgtcctatggtctt
gcagaggcgacgctggcggttaccgtcatgcccccgggcgaaggtatccgcgtggaactg
gttgaggaggagcgcctgtcgggcacgctgcgcgatctcagccgtcccgcgcgctatcgt
gccatcgtcaattgcggcaaaccgctgcccgatatggacgttgagatccgcggcgagaac
gatgccgtgaagggcgatcaccagatcggcaaagtctggtgccgcggccccagcgtgatg
cattcctatttccgggatgaggccgcgactggcgattgcctcgtcgatggctggctcgat
acaggagacatgggctatatggccgatggctatctgttcatcgtgggccgggccaaggat
atgatcattatcaatggcaagaaccattggccgcaggatatcgaatgggcagtggaacaa
ctgcccggcttcaaccacggcgatatcgcggccttctctgtcgaaaccgaaaatggcgag
gaagcgcccgccgtgctggtgcattgccgcgtatccgaccctgatgaacggatcaggctg
cgtgaccagattgcggacaaggtgcgcgctgttaccggcatgagctgcgttgtcgaactg
gtgccgccacggacgttgccacgcaccagcagcggcaaattgagccgcgccaaggcgaaa
aagctctatctttcgggtgagatttcgccattggacctggccgcttga

DBGET integrated database retrieval system