KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2806Help
Entry
ECSF_2806         CDS       T02077                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Brite
Enzymes [BR:ese01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     ECSF_2806
Lipid biosynthesis proteins [BR:ese01004]
 Acyl-CoA synthetase
  Unknown
   ECSF_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3073359..3075110
Genome map
AA seq 583 aa AA seqDB search
MISNFFVVYMSNKIFTHSLPMRYADFPTLVDALDYAALSSAGMNFYDRRCQLEDQLEYQT
LKARAEAGAKRLLSLNLKKGDRVALIAETSSGFVEAFFACQYAGLVAVPLAIPMGVGQRD
SWSAKLQGLLASCQPAAIITGDEWLPLVNAATHNNNPELHVLSHAWFKALPEADVALQRP
VPNDIAYLQYTSGSTRFPRGVIITHREVMANLRAISHDGIKLRPGDRCVSWLPFYHDMGL
VGFLLTPVATQLSVDYLRTQDFAMRPLQWLKLISKNRGTVSVAPPFGYELCQRRVNEKDL
AELDLSCWRVAGIGAEPISAEQLHQFAECFRQVNFDDSAFMPCYGLAENALAVSFSDEAC
GVVVNEVDRDILEYQGKAVAPGAETRAVSTFVNCGKALPEHGIEIRNEADIPVAERVVGH
ICISGPSLMSGYFGDQVSQDEIAATGWLDTGDLGYLLDGYLYVTGRIKDLIIIRGRNIWP
QDIEYIAEQEPEIHSGDAIAFVTAQEKIILQIQCRISDEERRGQLIHALAARIQSEFGVT
ADIDLLPPHSIPRTSSGKPARAEAKKRYQKAYAASLHVQESMA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
ttgatatccaattttttcgtggtgtatatgtctaataaaatctttacgcattccctacct
atgcgctatgccgattttccaacgctggttgatgctttggactacgccgctctgagtagc
gccggaatgaatttttatgacagacgttgccaacttgaagatcaactggaatatcagacg
ttaaaagcgcgtgccgaagctggtgcgaagaggttgttatcgctgaacctgaaaaaaggc
gatcgcgtggcgctgattgccgaaacgagtagcgggtttgtagaggctttttttgcctgc
cagtatgccggcttagtcgccgtcccgttggcgattccaatgggcgtcggtcagcgggat
tcctggagcgccaaactgcagggtttactggcaagttgccagcccgcagccattatcact
ggtgatgagtggttgccactggtcaatgccgcgacgcataacaacaaccccgaattacat
gttttaagccacgcctggtttaaggcattaccggaagccgatgttgcgctccagcgtcca
gttccaaacgatatcgcctacctccagtacacctccggcagcacccgttttccccgtggc
gttatcattactcaccgcgaagtgatggctaatctacgtgctataagccacgatgggatt
aaattacgccctggcgaccgctgcgtctcctggctgcctttctaccatgatatgggactg
gtcggctttctcctgacccccgtcgccacacagctttcagtagattatttgcgcactcag
gattttgccatgcgtcctctgcaatggcttaaattgatcagtaaaaatcgcggcaccgtt
tccgttgcaccgccgtttggctatgaattgtgccagcgccgcgtgaatgaaaaagatctc
gctgaactggatctttcctgctggcgcgtcgctggtattggcgcagaaccgatctccgca
gaacaactccatcaattcgctgaatgtttccgccaggttaactttgacgatagcgccttt
atgccctgctacgggctggcagaaaacgcgctggctgtcagcttctctgatgaagcctgc
ggggttgtggttaacgaagtggatcgcgatatcctcgaataccagggtaaagccgtcgcg
ccgggtgctgaaacacgcgccgtatcgactttcgtcaactgcggtaaagcgttgccggaa
catggcattgaaatccgcaatgaagcagatatacctgtcgcggaacgtgtggtaggccat
atttgcatctccggccccagcctgatgagcgggtactttggcgaccaggtttcgcaagac
gagattgccgcgacgggctggttagacaccggcgaccttggttatctgctggacggttat
ctgtatgtcaccggacgcattaaagatctgattattattcgtggccgtaatatctggccg
caggatattgaatacattgcggaacaggagccggaaattcattctggcgatgcgattgct
tttgttaccgcccaggaaaaaatcattttgcagatccagtgtcggatcagcgacgaagaa
cgtcgggggcagcttatccacgcgctggcagctcggatccaaagcgaatttggcgttacc
gcggatatcgatctgttgccgccccacagtattccccgaacatcctccggcaagcctgcc
cgtgcggaagcgaaaaaacgttatcagaaggcttatgctgccagtcttcatgtgcaggaa
tccatggcatga

DBGET integrated database retrieval system