KEGG   Exiguobacterium sibiricum: Exig_2940Help
Entry
Exig_2940         CDS       T00687                                 

Definition
(GenBank) Thermolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
esi  Exiguobacterium sibiricum
Brite
Enzymes [BR:esi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     Exig_2940
Peptidases [BR:esi01002]
 Metallo Peptidases
  Family M4: thermolysin family
   Exig_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 PepSY FTP
Motif
Other DBs
NCBI-ProteinID: ACB62386
JGI: Exig2940
UniProt: B1YFR1
LinkDB All DBs
Position
2922936..2924471
Genome map
AA seq 511 aa AA seqDB search
MKKFLATSLVASVLVVPTVVGAEGLQAGKLTKASSEPAASIVKEYVNKKGDFSVQDVQKD
GSSNIVRLQQEVDGVPVFGSVVVGNVAKDGTLKAVVNDAINVKGKPGLAKKASLSEKKAL
KLYQKAIKATEFEVAPKAELVIYPVKDDAVYAYKVTSTVLAGKEPSRWTYFIDANSGKVL
NKYDQLAHAKPVNTVTGTTSVGTGTTVLGTTATFNTVKSGSYYYLQDSTRGKGIYTYDAK
KRNTLPGSLWADLDNQFNTTYDRAAVSAQVNAVKTYDFYKNTYGRNSYDNAGAALNSSVH
YSTSYNNAFWDGTKMVYGDGDGSTFTYLSGALDVVAHELTHAVTEYTAGLVYQNESGAIN
EAVSDIMGTVAEYSVGSNFDWLVGEDIYTPGVSGDALRSMSNPAAYGDPDHYSKRYTGTQ
DNGGVHTNSGIVNKAAYLLGNGGTHTGVTVTGVGVPKLGAIYYRALSVYLTPNSNFSSLR
AAVVQSAKDLYGSTSAEATAAAKSFDAVGVY
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagtttctcgctacatcgcttgtcgcaagtgtacttgtcgttcctacagtcgtc
ggagcagaaggtcttcaagccggtaaactgacgaaagcatcatcagaaccagctgcatca
atcgttaaagagtacgtcaacaaaaaaggtgatttctctgtccaagatgtccaaaaagat
ggatcatctaacatcgtacgtctccaacaagaagtggatggcgtcccggtcttcggtagt
gtcgtcgtcggtaacgttgcgaaagacggtactttgaaagcagtcgtaaatgatgcaatc
aacgtcaaagggaaacctggtctcgctaaaaaagcatcactctctgagaaaaaagcactt
aaactttatcaaaaagccatcaaagcaacagaattcgaagtggctcctaaagcagaactc
gtcatctatccagtcaaagacgacgcggtctatgcttacaaagtcacatcaactgtcctc
gccggcaaagagccgtcacgctggacttacttcatcgatgcgaattcaggtaaagttctt
aataaatacgaccaactcgctcacgcaaaaccggtcaacacagttaccggaacgacttct
gtcggtacaggtactacggttctcggaactactgccactttcaacacagtgaagagcggt
tcttactactacttacaagattcgacacgcggtaaagggatctacacgtacgatgcaaaa
aaacgtaacacgcttccaggttcgctttgggcggatcttgataaccaattcaatacaaca
tacgaccgtgccgctgtcagcgcgcaagttaatgcagtaaaaacgtatgatttctacaaa
aacacatacggccgcaacagttatgacaacgcaggtgctgcacttaactcttcagtccac
tattcaacgagctacaacaatgcgttttgggatggaacgaagatggtctatggtgatgga
gacggttcaacattcacatacctctctggcgcacttgacgttgttgcccacgaattgacg
catgccgtcacagaatacacagctggactcgtctatcaaaatgagtcgggtgccatcaac
gaagcggtttccgatatcatgggaacagttgctgaatactcagtcggatcgaacttcgat
tggcttgtaggagaagacatctatacacctggtgtcagcggcgacgcactccgttcgatg
tctaacccggctgcttacggcgatccggaccactactcaaaacgctacacaggtacacag
gataacggtggtgtccacacgaactccggtatcgtcaacaaagccgcttaccttctcggt
aacggtggaacacacactggtgtcacagtcactggtgtcggcgtaccgaaactcggcgca
atctactaccgtgccctcagcgtttacttgactccgaactcgaacttcagctcgctccgc
gcagcagtcgttcaatcagcgaaagacctttacggttcgacaagtgcagaagcaacagca
gcagcgaaatcatttgatgctgtcggcgtctactaa

DBGET integrated database retrieval system