KEGG   Ensifer sojae: SJ05684_b51920Help
Entry
SJ05684_b51920    CDS       T05052                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
esj  Ensifer sojae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SJ05684_b51920
   00650 Butanoate metabolism
    SJ05684_b51920
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SJ05684_b51920
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SJ05684_b51920
Enzymes [BR:esj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SJ05684_b51920
Amino acid related enzymes [BR:esj01007]
 Aminotransferase (transaminase)
  Class III
   SJ05684_b51920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pSJ05684b:1132428..1133696
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKDGNRYIDFAAGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNALAPGDFAKKTIFVTTGAEAVENAVKIAR
AATGRQAIIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVSVEQS
LAALKKLFVADVDPGRVAAIILEPVQGEGGFYPAPTVFMKALREICDEHGILLIADEVQT
GFARTGKLFAMEHHNIAPDLLTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGSPI
GIAAAHAVLDVIEEEQLCDRANQLGNRLKQRLAAIREKTPEIVDIRGPGFMNAVEFNDAK
TNLPSADFANKVRLNALAKGLILLTCGVHGNVVRFLAPITIQDEVFAEALDILEASILEA
RS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaccgcaagaatgccgccatttcccgtggcgtgggaatgaccacg
cagatctatgcagaccgtgcggaaaatgccgaaatctgggacaaggatggcaatcgctac
attgatttcgccgccggcatcgccgtcgtcaataccggccatcgccatccgaaggtcatc
gcagccgtcaaggcgcagctcgatcgtttcactcatacctgccatcaggtcgtgccctat
gaaaactacgtgcatctcgccgaacggctgaacgctttggcccccggcgactttgcaaaa
aagacgatcttcgtcaccaccggcgccgaggcggtggaaaacgccgtcaagatcgcccgt
gcggccaccggacgtcaggcgatcatcgcctttggcggcggctttcacggccgcaccttc
atgggtatggcgctcaccggcaaggtcgttccctataaggtcgggttcggcgcgatgccg
gccgacgtcttccacgcccccttcccgatcgaactgcacggtgtcagcgtcgagcaatcg
cttgcagccttgaagaagctttttgtggccgatgtcgatccgggccgcgtcgccgccatc
atcctcgagccggtccagggcgaaggcggcttctatccggcaccgacggtcttcatgaag
gcgcttcgcgaaatctgcgacgagcatggcattctcttgattgccgatgaagtccagacc
ggttttgcccgcaccggcaagctcttcgcaatggagcatcacaatatcgcgccggacctg
ctgaccatggcgaaaagcctggccggcggcttcccgctcgccgcagtaaccggccgcgca
gagatcatggatgccccaggaccaggcggcctcgggggaacctatggcggcagcccgatt
ggcatcgcagcagcccatgccgtactcgacgtgatcgaggaggaacagctgtgcgaccgg
gcgaaccagctcggcaaccggctgaagcagcggcttgcagcaatccgcgaaaagacaccg
gaaatcgtcgacatccgcggtccgggcttcatgaatgcggtcgaattcaatgacgcgaaa
acgaatctgccgagcgccgacttcgccaacaaggtccggctcaatgcccttgcgaagggc
ctgattctgctcacttgcggcgtgcacggcaatgtcgttcgtttcctggcgccaatcacg
atccaggatgaggtcttcgccgaggcactggatattctcgaagcgtcgatcctcgaagcg
cgcagttga

DBGET integrated database retrieval system