KEGG   Ensifer sojae: SJ05684_c17920Help
Entry
SJ05684_c17920    CDS       T05052                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
esj  Ensifer sojae
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:esj00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SJ05684_c17920
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SJ05684_c17920
Enzymes [BR:esj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SJ05684_c17920
Peptidoglycan biosynthesis and degradation proteins [BR:esj01011]
 Precursor biosynthesis
  Racemase
   SJ05684_c17920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1752945..1754078
Genome map
AA seq 377 aa AA seqDB search
MGQFTFHAQDRLADADTGASGYLSIDLAALRRNYQKLSTAVAPATAAAVVKANAYGLGAE
YVSKALYAQGCRHFFVAHLTEAIELKPRLPDDTQLFVLNGLQPGTEVRCADAGAIPVLNS
IDQFRRWSSTAQKLGRVLRAVLQFDTGMSRLGLPPQERTALAAELKGCGNIEILFIMSHL
ACADEADNRQNTDQLAEMRRIAAAFPDLDVCLANSGGVFLGGDYHGVLARPGIALFGGAP
TAGRSNPMEAVVRLDVAVIQTRAVPAGTPVGYGGAYVTTTEARLATIAAGYADGLPRSMS
DRGAVFYDGVRLPIVGRVSMDSITVDVTALPEGALSLGSLVEVLGPHQTLEDVAEAAGTI
SYEILTSLGRRYERRYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgggccagttcacttttcatgctcaggatcgactagctgacgctgacacgggggcttcc
ggctatctgagcattgatcttgccgccttgcgtcggaactatcagaagctttccacggcc
gtcgcacccgcaacggccgcggccgttgtcaaggcgaacgcctacggcctcggtgccgag
tacgtgtccaaagccctgtatgcacaaggttgccggcatttcttcgttgcgcacctaacg
gaggcgatcgagctcaaaccgcgcctgccggacgacacgcaactcttcgtgcttaacgga
ttgcagcccgggacagaggtgagatgcgccgacgccggcgccattccggtgctcaactcc
atcgatcaattccggcgatggtcgtcgacggcgcaaaagctcgggcgcgtccttcgcgct
gtcttgcagttcgacaccggcatgtcgcgtctgggcctcccgccgcaggaacgaactgcg
ctcgcagccgaactcaagggctgcgggaacatcgaaatcctcttcatcatgagccatctc
gcctgcgccgacgaggcggacaacaggcagaataccgatcagctcgcggagatgcgccgt
atcgccgccgcgtttccagacctggatgtctgcctcgccaattcggggggcgttttcctc
ggcggcgactatcacggcgtcctggcccgaccgggcatagcccttttcggtggcgcaccc
acggcgggcagatccaatcccatggaagcggtcgtgcggctcgatgtggccgttatccag
acaagggcggttcccgccggaacgcctgttggctacggcggcgcgtacgtgacgactacc
gaggccaggctcgccacgatcgcagccggttacgccgacggccttccgcgcagtatgagc
gatcgcggcgccgtcttttacgacggcgttcgcctgccgatcgtcggccgggtttcgatg
gacagtatcacggtggatgtcacggcgctgcccgaaggcgcgctttcgcttggcagcctc
gtcgaggttctcggcccgcatcagacactggaagacgtggcggaagccgccggcacgatt
tcctacgaaatcctgaccagcctcggccgtcgctacgaacgccgatatcgctga

DBGET integrated database retrieval system