KEGG   Ensifer sojae: SJ05684_c27600Help
Entry
SJ05684_c27600    CDS       T05052                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
esj  Ensifer sojae
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:esj00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SJ05684_c27600
Enzymes [BR:esj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SJ05684_c27600
DNA repair and recombination proteins [BR:esj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SJ05684_c27600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2684467..2687061
Genome map
AA seq 864 aa AA seqDB search
MAARSEPLSEYNRRRDFTRTREPRGTVARGHQGRKRFLVQKHDATRLHFDFRLEWEGVLK
SWAVTRGPSLDPEDKRLAVRTEDHPLAYGDFEGTIPEGEYGGGTVMLWDTGWWEPEGDPT
EGLKKGKLSFRLYGSRMQGGWALVRMRPQRGEKRENWLLVKQSDGHAREDGDTLVEDQVT
SIRTGRTMEEIAAGKGEGQARVWHSNRSTAANLKAGAIAESVDRQRRRSRTSAKAPSFRP
PQLATLVTKAPAGDDWLSEVKFDGYRLICAVGGDGARCYTRNGLDWTGKFPAIASALAEL
DCKSALIDGEVVALSQEGSNFSALQKALKTGASTRLYAFDLIELDGKDLSRKPLVERKAK
LKALLDTLGVTATVQYSEHVRGNSAHVLAAMCRAGQEGILAKEANAAYRSGRTRSWLKVK
CTKRQEFVIGGYTPSSKKGRPFASLLVGTFESGKLVYRGGVGTGFTGKALEELAALFAGR
RRATPPFDAVPRERSRDGVWLKPDLVAEVDFAEFTDDGHIRHGSFQGLREDKEARAVKLE
TPNPTTAKAKTGTNKFPATKSARRTPKGEDEVLGIRISNPDRILFQGQGISKIDLARYYA
VVAERMLPLAADHPLSLVRCPQGRQRKCFYQKHASDGFPNDIREVPIEEASGETKNYMYL
HGAEGLVAAVQMGTLEFHIWGSTIDKLDQPDRLVFDLDPDPSVAFAIVKHAAAALRDELG
GIGLTSFALVTGGKGLHVVVPLVRRAAWDEVKRFAKAIAQRFADRDPDQFVATMSKAKRK
GRIFIDWLRNERGATAIAPYSTRAREGGPIATPVGWGELEALDAANTFQMADILKRIESD
TDPWREFGKARQSLTKKVLEAVGG
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgcagcgaaccgctttccgaatataatcgacgtcgcgatttcacccggacg
cgtgaaccgaggggaaccgtcgcgcgagggcatcagggcagaaagcgctttctcgtccag
aagcacgacgcgacccggctacatttcgacttccgcctcgaatgggagggcgtgctgaag
agctgggccgtcacgcgggggccgagcctcgaccctgaagacaagcgccttgccgtgcgc
acggaggatcacccgctcgcctatggcgatttcgagggcacgatccccgagggtgagtat
ggcggcggcacggtgatgctctgggacaccggctggtgggagccggaaggagacccgacc
gaggggctgaagaagggcaagctctccttccgcctctacggcagtcgtatgcagggcggt
tgggcgcttgtccgcatgcggccgcagagaggcgagaaacgcgaaaactggctgctcgtc
aagcagagcgacggccacgcccgcgaggacggcgatacgctcgtcgaagaccaggtgacg
agcatccgcaccggccgcacgatggaagagattgccgccggcaagggcgaaggacaagcg
cgcgtctggcattcgaacaggagcacggcggccaatctcaaggccggtgcgattgccgag
agcgtcgatcggcagaggcgccggtcgcgaacctccgcgaaggcaccgagcttccggccg
cctcagcttgcgacgctggtgacaaaggcacccgccggagacgattggctgagcgaggtg
aagttcgacggctaccggctgatttgcgctgtcggcggcgatggagcgcgctgctacacg
cgcaacggcctcgactggaccgggaaattccccgcgatcgcctccgcgcttgccgaactc
gactgcaagtcggcgctgatcgacggcgaagtggtggcgctgtcgcaggaaggctccaat
ttttcggcgctccagaaggcactcaagaccggtgccagcacccgtctatacgccttcgac
ctgatcgaactcgacggcaaggacctgagtcgtaaaccgctcgtcgaaagaaaggcgaag
ctgaaggcgctgctcgacacactcggcgtgacggcaacggtccagtacagcgagcatgtg
cgcggcaacagcgcgcatgtgcttgccgccatgtgcagggccgggcaggaaggcatcctc
gccaaggaggcgaacgctgcctatcgcagcggtcgaacgcggagctggctgaaggtcaaa
tgcacgaaacgccaggaattcgtgatcggcggctatacaccctcgtcgaaaaagggccga
cccttcgcgtccctcttggtcgggaccttcgagagcggcaagctcgtctatcgcggcggt
gtcggtaccggtttcaccggcaaggcgctcgaggaactcgctgcgcttttcgccgggcgc
agacgcgcgacgccgcccttcgatgcggtgccgcgggaacgaagccgcgatggcgtgtgg
ctgaagccggacctggtggcggaagttgatttcgccgagttcaccgatgacggccatatc
cgccacggctcgttccagggactgcgagaggacaaggaggccagggccgtgaaactggaa
acgccgaatcccacaaccgccaaggccaagaccggcacgaacaaattcccggcaacgaag
agcgccaggcgcacgccgaagggcgaggacgaggtgctcggcatccgcatctccaacccc
gaccggatcctcttccagggccaaggcatcagcaagatcgatcttgcccgctactatgcc
gtcgtcgccgagcggatgctgccgctcgcggccgatcatcccctctccctggtgcgctgc
ccgcaagggcggcagcggaagtgcttctaccagaagcatgcgagcgacggctttccgaac
gacatacgggaggttccgatcgaggaagcatccggcgagaccaagaactacatgtatctg
cacggtgccgaggggctggtcgccgccgttcagatggggaccctcgagtttcacatctgg
ggttcaaccatcgacaagctggatcagccggaccgcctggtcttcgacctcgatcccgac
cctagcgtcgccttcgccattgtgaagcacgcggccgcggcgctgcgagacgagctcggc
gggatcggcctgacctccttcgccctggtgaccggcggcaagggcctgcatgtggtcgtg
ccgcttgttcgccgcgccgcctgggacgaggtgaagcgctttgccaaggcgatcgcgcag
cgtttcgccgatcgcgatcccgaccaattcgtggccaccatgtcgaaggccaaacgaaag
ggccggatcttcatcgattggctgagaaacgaacgcggcgccacggcgatcgccccctat
tccacccgtgcgcgggagggcgggccgatcgccacgccggtcggatggggcgaactcgaa
gccctggatgcggccaatactttccagatggccgacatcctcaagcggatcgaaagcgac
acggatccctggcgggagttcggcaaggccaggcaatcgttgacgaagaaggtgctggag
gcggtcgggggctga

DBGET integrated database retrieval system