KEGG   Edwardsiella piscicida C07-087: ETAC_13810Help
Entry
ETAC_13810        CDS       T02509                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:etc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAC_13810
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_13810
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETAC_13810
   00430 Taurine and hypotaurine metabolism
    ETAC_13810
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_13810
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ETAC_13810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3110928..3112220)
Genome map
AA seq 430 aa AA seqDB search
MREDIAFQVINDELFLDGNARQNLATFCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAI
DLRCVNMVADLWHAPRPADGQAVGTNTIGSSEACMLGGMAMKWRWRAKRLAQGKSVDKPN
MVCGPVQVCWHKFARYWDVELREIPMAPGKLFMDPERMIAACDENTIGVVPTFGVTYTGN
YEMPDVLHKALDDLQARTGLDIDMHVDAASGGFLAPFCAPDIVWDFRLPRVKSISASGHK
FGLAPLGCGWVVWRDAASLPDDLIFKVDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGR
EGYTKVHTASYQVAQFLAAEIAKLGPYEFICSGDPQQGIPAVCFRIPAGKALGYSLYDLS
ERLRLRGWQVPAFALNGEMSDVVVMRIMCRRGFEMDFAQLLMEDFRAALAYLKAHPAVAN
VAHQNSFKHS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagacattgctttccaggttattaacgatgagctgtttttagacggcaatgcc
cggcaaaacctggcgacgttttgtcagacctgggatgacgactatgtacaccgcctgatg
gatatttcgatcaataaaaactggatcgataaagaggagtatccgcagtcggcggcgatc
gatctgcgctgcgtcaatatggtggccgatctgtggcatgcgccgcgcccggcggatgga
caggccgtcggtaccaatactatcggctcctccgaggcctgcatgctgggcggcatggcg
atgaagtggcgctggcgcgccaagcgtctggcgcagggaaaatcggtggataagcccaac
atggtgtgcgggccggtacaggtctgctggcataagtttgcccgctactgggatgtcgaa
ctgcgcgagatcccgatggcgcccggcaagctgtttatggatccggagcggatgatcgcc
gcctgcgatgagaacaccatcggcgtcgtgccgacctttggcgtcacctacaccggtaac
tatgagatgcctgacgtgctgcacaaggcgctggacgatctgcaggcgcgtaccgggctg
gatatcgacatgcacgtcgacgccgccagcggcggcttcctggcaccgttctgcgccccg
gatatcgtctgggacttccgtctgccgcgggtgaaatccatcagcgcatccggccataag
ttcggcctggcaccgctcggctgcggctgggtggtgtggcgtgacgccgcctctttaccg
gacgatctgatctttaaggtggactatctgggcggacaggttggcacctttgccattaac
ttctcccgtcccgcgggtcaggtgatcgcgcagtactatgaattcctgcgtctgggacgc
gagggctacaccaaggtgcataccgccagctatcaggtggcgcagttcctggcggcggag
atcgctaagctgggaccctatgagtttatctgcagcggcgatccgcagcagggtattccg
gcggtgtgcttccgcattccggctggcaaggcgctgggctatagcctgtacgatctctcc
gagcgcctgcgcctgcgcggctggcaggttccggcctttgcgttgaacggtgaaatgtcc
gacgtggtggtgatgcgcatcatgtgccgccgcggctttgagatggattttgcccagctg
ctgatggaggacttccgcgcggcgctggcctatcttaaggcccatccggcagtggccaat
gtggcgcatcagaacagcttcaaacattcctga

DBGET integrated database retrieval system