KEGG   Edwardsiella anguillarum: ETEE_1091Help
Entry
ETEE_1091         CDS       T03245                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00250  Alanine, aspartate and glutamate metabolism
ete00410  beta-Alanine metabolism
ete00430  Taurine and hypotaurine metabolism
ete00650  Butanoate metabolism
ete01100  Metabolic pathways
ete01110  Biosynthesis of secondary metabolites
ete01120  Microbial metabolism in diverse environments
ete02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ete00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ETEE_1091 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETEE_1091 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETEE_1091 (gadB)
   00430 Taurine and hypotaurine metabolism
    ETEE_1091 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ETEE_1091 (gadB)
Enzymes [BR:ete01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ETEE_1091 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AIJ07554
UniProt: A0A076LPI6
LinkDB All DBs
Position
complement(1045162..1046556)
Genome map
AA seq 464 aa AA seqDB search
MKKGTDTRGGYLDSRFGSETIRTAAEAHHFPQGEMREDIAFQIINDELFLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPRPADGQAIGTN
TIGSSEACMLGGMAMKWRWRAKRLAQGKPADKPNMVCGPVQVCWHKFARYWDVELREIPM
APGKLFMDPERMIAACDENTIGVVPTFGVTYTGNYEMPDVLHKALDDLQARTGLDIDMHV
DAASGGFLAPFCAPDIVWDFRLPRVKSISSSGHKFGLAPLGCGWVVWRDAASLPEDLIFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVHTASYQVAQFLAAEIAKLGP
YEFICSGDPQQGIPAVCFRIPAGKELGYSLYDLSERLRLRGWQVPAFALNGEMSDVVVMR
IMCRRGFEMDFAQLLMADFRAALAYLKAYPAVAHVAHQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtactgacacccgtgggggatatttggattcccgctttggttcagagact
attcgcacggcggcggaggctcaccattttcctcagggagaaatgcgcgaagacattgct
ttccagattattaacgatgagctgtttttagatggcaatgcccggcaaaacctggcgacg
ttttgccagacctgggatgacgactatgtacaccgcctgatggatatttcgatcaataaa
aactggatcgataaagaggagtatccacagtcggcagcgatcgatctgcgctgcgtcaac
atggtggccgatctgtggcatgcgccgcgtccggcggacgggcaggccatcggtaccaat
accatcggctcctccgaggcctgcatgctgggcggcatggcgatgaagtggcgctggcgc
gccaagcgtctggcgcagggaaaaccagcggataaacccaatatggtgtgcgggccggta
caggtctgctggcataagtttgcccgctactgggatgtcgaactgcgcgagatcccgatg
gcgcccggcaagctgtttatggatccggagcggatgatcgccgcctgcgatgagaacacc
atcggcgtcgtgccgaccttcggcgtaacctacaccggtaactatgagatgcctgatgtg
ctgcacaaggcgttggacgatctgcaggcgcgtaccgggctggatatcgacatgcacgtc
gacgctgccagcggcggcttcctggcgccgttctgcgccccggatatcgtctgggacttc
cgcctgccgcgggtcaaatccatcagctcatccgggcataagttcggcttggcgccgctc
ggctgcggctgggtggtgtggcgcgacgccgcctccctgccggaggatctgatctttaag
gtggactatctgggtggacaggtcggtacctttgccattaacttttcccgtcccgcgggc
caggtgatcgcgcagtactatgagttcctgcgtctgggacgcgagggctacaccaaggtg
cataccgccagctatcaggtggcgcagttcctggcggcggagatcgctaagctggggccc
tatgagtttatctgtagcggtgatccgcagcagggcatcccggcggtgtgcttccgcatt
ccggccggcaaggagttgggctatagcctgtacgatctctccgagcgcctgcgcctgcgc
ggctggcaggttccggcctttgccctgaacggcgaaatgtccgatgtggtggtgatgcgc
atcatgtgccgccgcggctttgagatggacttcgctcagctgctgatggcggacttccgc
gcggcgctggcctatctcaaggcctatccggcagtggcccatgtggcgcatcagaacagc
ttcaagcattcctga

DBGET integrated database retrieval system