KEGG   Edwardsiella anguillarum: ETEE_1111Help
Entry
ETEE_1111         CDS       T03245                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00730  Thiamine metabolism
ete00790  Folate biosynthesis
ete01100  Metabolic pathways
ete02020  Two-component system
Module
ete_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ete00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ETEE_1111 (phoA)
   00790 Folate biosynthesis
    ETEE_1111 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETEE_1111 (phoA)
Enzymes [BR:ete01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ETEE_1111 (phoA)
Exosome [BR:ete04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETEE_1111 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ete00537]
 Enzymes
  ETEE_1111 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AIJ07574
UniProt: A0A076LPK5
LinkDB All DBs
Position
complement(1065240..1066682)
Genome map
AA seq 480 aa AA seqDB search
MASHPPFSLSLLMLSLSLALPLQAAPSAPSAEQVLTERAARGDITQRGGARRLLGDQTAA
LQASLSARPAKNVILLIGDGMGDAEITAARNYAAGAGGMLRGIDALPLTGQYTHYSLDRQ
THRPNYVTDSAASATAWSSGVKTYNGALGIDVTGKPHPTLLELARAAGKATGNVSTAELQ
DATPAAMFAHVSGRKCYGPQQTLEKCPENALDNGGAGSITEQMLKARADVTLGGGAKTFT
QTVSSGAFKGKNLRQQAQAQGYHIVSNLDEMNAVTEADDRRPLLGLFAEGNMPVRWLGPK
ATRHGNRQAPVTCQPNPQRSDSQPSLAQMTDKAISLLSKNPNGFFLQVEGASIDKQDHAA
NPCGQFGETVDLDEAVQKALAFARRDGNTLVVVTADHAHTSQIIPNDAKAPGLTQTLITQ
DGVPMTISYGTAEEADSQEHTGSQLRIAAYGPHGANVVGLTDQTDLFFTLRDALGLKSAP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccatccccctttttccctttctctgctgatgctttctcttagcttggccctg
ccgctgcaggccgcgccctccgcgccgagcgcagagcaggtgcttaccgaacgcgccgcg
cgcggcgatatcacccagcggggaggcgcccgccgcctgctcggcgatcagaccgcggcg
ctgcaggcgtcgctgagcgcccgtccggccaagaacgtgatcttactgatcggtgatggc
atgggcgatgcggagatcaccgccgcccgtaattatgcggccggcgcgggcggaatgctg
cgcggcatcgatgccctgccgctgaccgggcagtacacgcactattcgctggatcgccaa
acccaccgaccgaactatgtcaccgactcggcggcctcggcgaccgcctggagcagcggg
gtaaagacctataacggcgccttgggcatcgatgtgacgggtaagccgcatccgacgcta
ctggagctggcgcgcgcggcgggcaaggccaccggaaacgtctcgaccgcagagctgcag
gacgccacgccagcggcgatgttcgcccacgtcagtgggcgcaaatgctatggcccgcag
cagaccctggagaaatgcccggagaatgcgctggataacggcggcgccggatcgatcacc
gagcagatgctgaaggcgcgtgccgatgtgacgctgggcggcggggcgaagacctttacg
cagacggtgagctcgggggcgtttaagggaaaaaacctgcgccagcaggcgcaggcgcag
ggctaccacatcgtcagcaatctggatgagatgaacgctgtcacggaggcggacgatcgg
cgtcctttgctgggcctgttcgccgagggcaacatgccggtgcgctggctggggcccaag
gccacgcgacatggcaaccgtcaggcgccggtgacctgccagccgaatccgcagcgcagc
gacagccagccgagcctggcgcagatgaccgataaggccatctcgctgctgagcaagaat
cccaacggctttttcctgcaggttgagggggcgtcgatcgataagcaggatcacgccgcc
aatccgtgcggtcagtttggcgagacggtcgatctggacgaggcggtgcagaaggcgctg
gcgtttgcccgccgcgatggcaacaccctggtggtggtcacggccgaccacgcccacacc
agccagatcatccccaacgatgccaaggcgccggggctgacgcagacgctgatcacccag
gatggggtaccgatgaccatcagctacggcaccgccgaggaggcggatagccaggagcat
accggctctcagctgcgcatcgccgcctacggtccccacggggccaacgtggtcggcctg
acggatcagaccgatctgttctttaccctgcgcgatgcgctgggactgaagagcgcccct
taa

DBGET integrated database retrieval system