KEGG   Edwardsiella tarda EIB202: ETAE_0247Help
Entry
ETAE_0247         CDS       T01121                                 

Gene name
sodC
Definition
(GenBank) copper-zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
etr  Edwardsiella tarda EIB202
Brite
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ETAE_0247 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACY83094
UniProt: D0ZA04
LinkDB All DBs
Position
273143..273670
Genome map
AA seq 175 aa AA seqDB search
MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPAIGEVTVSETPYGLLFTPSLHGL
PQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMGPYSDAGHLGDLPGLVV
NADGTANYAVLAPRLKSLSQLKGHALMVHVGGDNYDDHPHALGGGGARMACGVIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaaaatattggtactggccaccgcgttgatgagcggggctgcctacagc
gcctctgagtcgataacgctgtatgaagcggggccgcagggggcggggccggcgatcggt
gaggtgacggtcagcgaaacgccctatggtctgctgtttacgcccagcctgcacggtctt
ccgcaggggatccacggttttcatgtccatgaaaacgccagctgcctgccgggcgtcaaa
gagggtaaaccggtgccggccctgatggccggtggccactgggatcccgagaagcgcggt
aagcatatggggccctacagcgatgccgggcacctgggcgatctgccgggactggtggtc
aatgcggacggtacggcaaactatgccgtgctggcgccgcgtttgaaatcgctctcccag
ctgaagggacatgcgctgatggtgcacgtcggcggcgataactatgacgatcatccgcac
gcgctgggcggcggcggggcgcgtatggcctgcggcgttattcagtaa

DBGET integrated database retrieval system