KEGG   Exiguobacterium sp. U13-1: ESP131_07500Help
Entry
ESP131_07500      CDS       T04561                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
exu  Exiguobacterium sp. U13-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:exu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ESP131_07500
Enzymes [BR:exu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ESP131_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1480841..1482382)
Genome map
AA seq 513 aa AA seqDB search
MKQKRWILATVASAAFLAPLAQPIAVGATADNGTMMQYFEWYVPNDGNHWNRLGSDATKL
DQLGITSVWIPPAYKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKTAIGQLHT
AGIDVYGDVVMNHKGGADFTEAVTAVEINPGNRNQEISGDYQIQAWTGFNFAARNNLYSN
FKWKWYHFDGTDWDQSRSKSAIYKFRGTGKAWDTDVSTENGNYDYLMYADLDFDHPEVQQ
EMKNWGKWYVNELGLDGFRLDAVKHIKHGYLADWLANVRQTTGKPLFTVAEYWQNDLGTL
QNYLSRTNYQQSVFDAPLHYKFEQASKGGGYYDMRTIFDGTLVKSNPVQAVTLVENHDSQ
PGQSLESTVQSWFKPLAYAMILTREQGYPSVFYGDYYGTKGTSNREIPALASKIDPLLKA
RKDFAFGKQNDYLDNQDIIGWTREGVSDRAKSGLATILSDGPGGSKWMYVGLQNKGEVWT
DITGNNTKSVTINQDGYGQFFVNGGSVSVYRQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaaaaagatggattttagcaaccgtcgcatctgctgcttttttagcgccactt
gcgcaaccgattgcagtcggcgcaacggcagacaacggaacgatgatgcagtatttcgaa
tggtatgtgccaaatgacggtaaccactggaaccgtctcgggagtgacgcaacaaagctc
gatcagctcgggatcacatcggtctggattccccctgcttacaaaggtacctcgcaaaat
gatgtcgggtacggtgcctacgatttgtacgatttaggtgagttcaaccaaaaaggaacg
gtccgtacgaaatacggcacaaaggcgcaattaaaaacggcaatcggacaattgcatacc
gctggaatcgatgtctatggcgatgtcgtcatgaatcataaaggtggcgccgatttcacg
gaagccgtcacggcagtcgaaatcaatccgggtaaccgtaatcaagaaatctcgggcgat
tatcaaatccaggcatggacgggattcaattttgcagcacgaaataacctatactcaaac
ttcaaatggaaatggtaccatttcgacggcacggactgggatcaatcgcgttcaaaaagc
gccatctacaagttccgcggtaccggtaaagcgtgggatacggatgtctcaactgaaaat
ggcaactatgattacttgatgtatgcggatctcgacttcgatcatccagaagtccagcaa
gaaatgaagaactggggaaaatggtacgtcaacgaacttggtcttgatgggttccgtctc
gatgccgtcaagcatatcaaacacggttacttagcggactggctcgcaaacgttcgtcag
acgacgggtaaaccattgttcacagtcgcagagtattggcagaacgatctcggcacgttg
caaaactacttaagccgaacgaattatcaacaatccgtctttgatgcaccgcttcattat
aagttcgaacaggcaagtaaaggcggcgggtattacgacatgcggacgatctttgacggt
actctcgttaagagtaatccagtccaggccgtcacactcgttgagaaccatgattcgcaa
cctggacaatcgcttgaatcaacggttcagtcatggttcaaacctcttgcttacgcgatg
atcctgacacgtgaacaaggttatccgtcggtcttttatggtgactactatggtacaaag
ggcacgtcgaatcgcgaaattccagcactcgcttcgaagattgatccgttactcaaagca
cggaaggacttcgcgttcggtaaacaaaatgattacctcgataaccaagatatcatcggt
tggacacgtgaaggcgtctcagaccgagcgaaatccggtcttgcgacaatcctttcagat
ggtcctggcggtagcaagtggatgtacgtcggtcttcagaacaaaggagaagtttggaca
gacatcaccggtaacaacacgaagtcggttacgatcaaccaagatggctacggtcaattc
ttcgttaacggtggttcggtctccgtctatcgtcaacaataa

DBGET integrated database retrieval system