KEGG   Ficedula albicollis (collared flycatcher): 101806256Help
Entry
101806256         CDS       T02815                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101806256 (PTGS1)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101806256 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
17
AA seq 586 aa AA seqDB search
MQGCGGWMMMCLSLSLPAVNPCCYFPCQNQGVCVRVGLRGYECDCTRTGYYGVNCTSPEF
WTHLHNLLKPSPAFYHFILTHFKWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDY
GYISWEAYANVSYYTRVLPPVPDDCPTPMGTKGKMQLPDPQLLAERFLLRQKFEADPRGT
NMMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKF
QVVDGEVYPPMVSEAPVHMVYPSGVPKEQQLAVGQEVFGLLPGLCVYATLWLREHNRVCD
LLKRDHPTWSDEQLFQTARLILIGETIKIVVEDYVQHLSGYYLSLKFDPELLFGSQFQYR
NRIAVEFNQLYHWHGLMPDSFVIQGQEYSYKQFLYNTSMLMDYGVEALVESFSKQIAGRI
GGGQTINANVLHVAVGVIKESRQLRLQPFNEYRKRFGMKPYKSFQELTGEEEKAAELEEL
YGDIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLFGNPICSPEYWKPSTFGGET
GFEIVKTASLEKLVCLNVKKCPYVAFHVPDTAEHGSPRAGGSSTEL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcagggatgtggtggctggatgatgatgtgtctctctctctctctccctgcagtgaat
ccctgttgctatttcccctgccagaaccaaggggtgtgtgtgagggtcggtctgagagga
tacgagtgtgactgcacacggacagggtactacggggtcaactgcacctcccctgagttc
tggacacacctgcacaacctgctgaagcccagtcctgccttctaccatttcatcctgacc
cacttcaagtggttttgggacattatcaacagcaccttcatcagggacacgctcatgagg
ctcgtgctgacagttcgtgccaatctcatccccagcccccccactttcaactctgactat
ggctacatcagctgggaggcttatgccaacgtcagctattacacccgtgtcctcccgccc
gtgccggacgactgccccacgcccatggggaccaaagggaagatgcagctccctgacccc
cagctcctggcagagaggtttctgctgcggcagaagtttgaagctgatccccgaggcacc
aacatgatgtttgccttcttcgcccagcatttcacccaccagttcttcaagacatctggg
aagatggggcgtggcttcaccaaggctctggggcacggggtggacctgggacatctgtac
ggggacaacctgcagcgccagcaccagctgcgactcttccgagacgggaagctgaaattc
caggtggtggatggagaggtgtacccgcccatggtcagcgaggctccggtgcacatggtg
tacccgtcgggcgtgcccaaggagcagcagctggcggtggggcaggaggtgttcgggctg
ctgccggggctctgtgtctatgccactctctggctgcgtgagcacaaccgtgtctgcgat
ctcctcaagcgggaccatcccacctggagcgacgagcagctcttccagacagcacggctc
atcctcatcggggagaccattaagattgttgttgaagactacgtccagcacctcagtggg
tactacctgagcctcaagtttgaccccgagctgttgtttgggtcacagttccagtaccgg
aatcgcatcgcggtggagttcaaccagctctatcactggcacgggctgatgcccgactcc
ttcgtcatccagggacaagagtacagctacaagcagttcctctacaacacctccatgctc
atggactacggggtggaggcactggtggagtccttttccaagcagattgcaggaaggatt
ggtgggggacagaccatcaatgccaatgtcctgcacgtggccgttggggtcatcaaggag
tcccggcagctgaggctacagcccttcaatgagtatcggaaaaggtttggcatgaagccc
tacaagtccttccaggagctgacaggagaggaagagaaggcagcagagctggaagagctg
tatggagacattgatgctctggagttttacccaggcttgctgctcgagaaaccccaaccc
aatggcatttttggggaaagcatggtggagattggagctccattttccctgaaggggctt
tttggcaatcccatctgctccccagagtactggaagcccagtacatttggtggagaaact
ggctttgagatcgttaagacagcatccctcgagaagcttgtgtgcctcaacgtgaagaag
tgcccgtacgtggcgttccacgtgccggacactgcagagcacggcagcccccgggctggt
gggtcatctacagagctctag

DBGET integrated database retrieval system