KEGG   Ficedula albicollis (collared flycatcher): 101810322Help
Entry
101810322         CDS       T02815                                 

Gene name
HK2
Definition
(RefSeq) hexokinase-2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101810322 (HK2)
   00051 Fructose and mannose metabolism
    101810322 (HK2)
   00052 Galactose metabolism
    101810322 (HK2)
   00500 Starch and sucrose metabolism
    101810322 (HK2)
   00520 Amino sugar and nucleotide sugar metabolism
    101810322 (HK2)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101810322 (HK2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101810322 (HK2)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101810322 (HK2)
Membrane trafficking [BR:fab04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101810322 (HK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
22
AA seq 917 aa AA seqDB search
MIASHLLAYFFTELNHDQTQKIDKYLYHMRLSDETLLEVSQRFEKEMEKGLGADTNPTAS
VKMLPTFVRSTPDGTEDGDFLALDLGGTNFRVLRVKVSDNGLRKVEMENQIYAIPEELMR
GSGVQLFDHIAECLANFLDKLQIKDKKLPLGFTFSFPCHQTKLDESILVTWTKGFKCSSV
EGRDVVSLLRKSIRKRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEVGLIVGTGTNACYME
EMRHIDLVEGDEGRMCINMEWGAFGDDGVLNDIRTEFDREIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEGLLFGGRLTPDLLTTGHFETRFVSAIEKEKEGLQKAHEILSKLG
LEPSHEDCLATLRICQIVSTRSASLCGATLAAVLRRIKDNKGVERLRSTVGVDGSVYKKH
PHFARRLHKTVRKLLPDCEIRFIRSEDGSGKGAAMVTAVAYRLAAQHKARQKILEPLKLS
HEQLLEVKERMRIEMEKGLGKETHAEATVKMLPTYVCSTPDGTEKGDFLALDLGGTNFRV
LLVRVRNGMRRGVEMHNKIYSIPVEIMQGTGEELFDHIVHCISDFLEYMGMKGVSLPLGF
TFSFPCQQNNLDEGILLKWTKGFKATGCEGEDVVGLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGYEDPYCEVGLIVGTGSNACYMEEMRNVELVEGDEGRMCVNMEWGAFGDSGCLDD
IRTEFDVAVDELSLNPGKQRYEKMISGMYLGEIVRNILMDFTKKGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRSILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDKIRENRGLDFLKITVGVDGTLYKLHPHFSNILHETVKQLSPKCEVTFLQSEDGSGKG
AALITAVACRIREAGQR
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcttcgcacctcctcgcttacttcttcaccgagctcaaccatgaccagacacag
aagatcgacaagtacctgtaccacatgcggctctcggatgagaccctcctggaggtgtcc
cagcgctttgagaaggagatggagaaggggctgggggccgataccaaccccaccgcctcg
gtgaagatgctgcccaccttcgtcaggtccaccccggatgggacagaggacggggatttc
ctggcgctggacctcggcggcaccaacttccgcgtgctgcgggtgaaggtgtcggacaac
gggctgcgcaaggtggagatggagaaccagatctacgccatccccgaggagctgatgcgc
ggcagcggggtgcagcttttcgaccacattgctgagtgtttggccaacttcctggacaag
ctgcaaatcaaagacaagaaactcccccttggcttcaccttctccttcccgtgtcaccag
accaagctggatgagagcatcctggtgacgtggacgaaggggttcaagtgcagcagcgtg
gaggggagggacgtggtgtcactgctgcgcaagtccatcaggaaaagaggggactttgac
atcgacatcgtggccgtggtgaatgacaccgtgggaaccatgatgacctgtggctacgat
gaccacaactgtgaagttggcctcattgttggtactggtaccaacgcctgctacatggag
gagatgaggcacattgacctggtggagggggatgaaggtcggatgtgcatcaacatggag
tggggggcctttggtgacgatggggtgctcaacgacatccgcaccgagttcgaccgtgag
atcgacatgggctcgctcaaccctggcaaacaattgtttgagaagatgatcagcgggatg
tacatgggggagctggtcaggctcatcctggtgaagatggccaaggaagggctgttgttt
ggggggaggctcacgccggatctgctcaccaccggccactttgagaccagatttgtctct
gccattgagaaggagaaggaagggctgcagaaagcccacgagatcctgagcaagctgggg
ctggagccgtcgcacgaggactgcctggccacgctgcgcatctgccagatcgtgtcgacg
cgctcggccagcctgtgcggcgccacgctggccgcggtgctgcgccgcatcaaggacaac
aagggcgtggagcggctgcgctccaccgtgggcgtggacggctctgtctacaagaaacac
ccgcactttgcccgtcgcctccacaagaccgtgcggaagctgctgccggactgtgagatc
cgcttcatccgctccgaggacgggagcggcaagggagcggccatggtgacagcggtggcc
tacaggctggctgcacagcacaaggcccggcagaagatcctggagcccctcaagctgagc
cacgagcagctgctggaggtgaaggaaaggatgaggatagagatggagaaagggctgggc
aaggagacgcacgcagaggccacggtgaaaatgctgcccacctacgtgtgctccactcct
gatggaacagaaaagggagatttcctcgccctggacctgggaggaaccaacttccgcgtg
ctgctggtgcgcgtcaggaacgggatgcggcgcggggtggagatgcacaacaagatctac
tccatccctgtggagatcatgcaggggacgggagaggagctctttgaccacattgtccac
tgcatctccgacttcctggagtacatggggatgaagggcgtgtcgctcccgctgggattc
accttctccttcccttgccagcagaacaacctggatgagggaattctcctgaagtggaca
aaaggtttcaaggcgacgggctgcgagggagaggacgtggtgggcctgctgaaggaggcc
attcacaggagagaggaattcgacctggacgtggtggcagtggtcaatgacacagttggc
accatgatgacctgtgggtatgaggatccctactgtgaagttgggctgattgttggcacg
ggcagcaatgcctgctacatggaggagatgaggaacgtggagctggtggaaggggatgag
ggcaggatgtgtgtcaacatggagtggggggccttcggggacagcgggtgcctggacgac
attcggacggagttcgacgtggcggtggatgagctgtccctcaaccctgggaagcagagg
tacgagaagatgatcagtgggatgtacctgggggaaatcgtccgcaacatcctgatggac
ttcaccaagaaagggctgctcttccggggacggatctcggagaggctgaagaccagaggg
atctttgagaccaaattcctgtcccagatagagagcgactgcctggccctgctccaggtg
cgctccatcctgcagcacctggggctggagtccacgtgcgacgacagcatcatcgtgaag
gaggtgtgcacggtggtggcgcggcgcgcggcgcagctctgcggcgccggcatggccgcc
gtggtggacaagatccgcgagaaccgcggcctggacttcctcaaaatcaccgtcggcgtg
gacgggacgctctacaagctgcaccctcacttctccaacatcttgcacgagacagtgaag
cagctgtcccccaagtgtgaagtgaccttcctgcagtcggaggacggcagcggcaaaggc
gccgcgctcatcacggccgtggcctgccgcatccgcgaggccgggcagcggtag

DBGET integrated database retrieval system