KEGG   Ficedula albicollis (collared flycatcher): 101814531Help
Entry
101814531         CDS       T02815                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101814531 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101814531 (SOD2)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101814531 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 272 aa AA seqDB search
MASARTRRPGWPRGVSPAARPSSAPAAGAEGGRAAAAPSESCPAPDAAMLRRFAAAGRSS
ARFVAPLGCLVSRQKHTLPDLPYDYAALEPHINAEIMQLHHSKHHATYVNNLNVVEEKYK
EALAKGDVTAQVSLQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELMEAIKRDFGSFAN
FKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYY
LQYKNVRPDYLKAIWNVINWENVSSRYATSKK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagcccgaacgcgcaggccggggtggccgcggggtgtgtcccccgcggcccgg
ccgagctcagcccccgcggccggggcggagggagggcgggccgcggctgcgccgtcagag
tcgtgcccggctccagacgccgccatgttgcgccgcttcgccgccgcgggcagaagcagt
gccaggtttgtagcaccattggggtgcttggtttctaggcaaaagcacactcttcctgac
ttgccatatgactatgctgctctggaacctcatattaatgcagagatcatgcagctgcac
cacagcaagcatcatgccacctacgtgaacaacctgaatgttgtcgaggagaagtacaaa
gaggcactggcaaaaggtgatgttacagctcaggtatcacttcaacctgcactgaagttc
aatggtgggggtcatatcaatcacagcatcttctggacaaacctttctcctaatggagga
ggggagcctaaaggggaattgatggaagccatcaagcgtgactttggttcctttgcaaac
ttcaaggagaagcttacagctgtatcagttggtgttcaaggatcaggctgggggtggctt
ggctataacaaggagcaggggcgcctacagatagcagcttgtgcaaatcaagaccctttg
caaggaacaacaggtctcattcctttgctaggcattgacgtatgggaacatgcttattat
cttcagtacaaaaatgttcgacctgattatttgaaggccatctggaatgtgatcaactgg
gagaacgtatcttcaagatatgcaacttccaagaagtag

DBGET integrated database retrieval system