KEGG   Ficedula albicollis (collared flycatcher): 101814847Help
Entry
101814847         CDS       T02815                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101814847 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 630 aa AA seqDB search
MDPRSDRGRFASVRLQGAPRAGPAPSGPAPRALWRRLAAKCGCCGCCGNRDRNRDWEPVP
GEVPGRRAAQPIRPGLLAPVRLRPGASANRVAHHTQEFAQRPLVVRRGQRFHLGVALPRP
LREDDALCIELTLGPTPQVAKGTHVLVPLGGASATGWTAELDEGVTEPVGGVAGSDHALW
VGLTAPPTAPIGRYRLSVRTRTEAGEFAAPFEPDNDVVLLFNPWCEGISRVNSLDDSGVL
VGNWTGDYSQGTNPSAWAGSVGILRSFHGSGAPVRYGQCWVFAGVVTTVLRCLGLPTRTV
TNYNSAHDTDTSLTTDIYLDEAMRPLERLNTDSVWNFHVWNDCWMKRPDLPDGYDGWQVV
DATPQETSSGLFCCGPCSVTAVKNGEVFLKYDTPFVFAEVNSDKVYWQRQAHGGFSVVHV
EPGAIGRRISTQGPGMARVDITDQYKHPEGEGPLFRSRTLPPGQEDTVTMTVAYPEYQPH
VGDQDALKLTVAGAVQETGQVLAKELLVRLHTPELTLTLLGPAVVGQEVPVQVVFQNPLP
KALSGASLRMEGAGILCPKPAALGSVGAGQTLRLSQSVTPLRAGRRRLVAALESAALPPL
HGSLQFEAVTGSTGSTGSLPGETGSGGRGR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggatccccgctccgatcgcggccgtttcgcctccgttcgcctccagggggcgcctcgc
gccggccccgccccctcgggccccgcccctcgcgcgctctggcgccgcctggcggccaaa
tgcggctgctgcggctgctgcgggaatcgcgacaggaaccgcgactgggagcccgtcccg
ggggaggtgccgggcaggagagcggcgcagcccatccggccaggcctattggctcccgtc
aggctccgccccggcgcctcggccaatcgcgtggctcatcacacccaggagttcgcgcag
cgccccctggtggtcaggagagggcagcgcttccacctgggcgtggccctgccccgcccc
ctccgcgaggacgacgccctctgcatcgagctgaccctgggccccaccccgcaggtggcc
aagggcacacacgtgctggtgccgctgggcggggcctcggccacgggctggacggccgag
ctggacgagggcgtgaccgagccggtggggggcgtggccggaagtgaccacgccctgtgg
gtggggctgacggccccgcccacggctcccattggccgctaccggctgagcgtgcgcacc
aggaccgaggccggcgagttcgcggcgcccttcgagcccgacaacgacgtggtgctgctg
ttcaacccctggtgtgagggaatttcgagggtgaactccctggacgacagcggggtgctg
gtggggaactggaccggggattattcccagggcaccaacccctcggcctgggccggctcc
gtggggatcctgcgcagcttccacggctccggcgcccccgtgcgctacggccagtgctgg
gtgttcgccggcgtggtcaccacggtgctgcgctgcctgggcctccccacccgcacggtc
accaattacaactccgcccacgacacggacacgtcgctgaccaccgacatctacctggac
gaggccatgcggcctctggagcggctcaacaccgactccgtctggaatttccatgtgtgg
aacgactgctggatgaagcgccctgatctccccgacggctacgacgggtggcaggtggtg
gacgcgacgccgcaggagaccagcagcggtctgttctgctgcgggccctgctccgtcacc
gccgtgaagaacggggaggttttcctcaagtacgacacgcccttcgtcttcgctgaggtt
aatagcgacaaggtgtactggcagcggcaggcgcacggcgggttctcggtggtgcacgtg
gagcccggagccatcggccgcaggatcagcacccaggggccgggaatggccagagtggac
atcactgaccagtacaagcaccccgagggtgaggggccgctcttccgatctcggacgctg
ccccccgggcaggaggacacggtgaccatgacagtggcctaccctgagtaccagccccac
gttggggaccaggacgctctgaagctgacagtggctggcgccgtgcaggagacggggcag
gtcctggccaaggagctgctggtgcggctgcacacgcccgagctgacgctgacgctgctg
ggcccggccgtggtgggacaggaggtccccgtgcaggtggttttccagaacccgctgccc
aaagctctgagcggcgcctcgctgcgcatggagggagccgggatcctctgccccaaaccc
gcagcgctgggctcggtgggggcggggcagaccctccgcctgagccaatccgtgaccccg
ctccgcgcaggacggcgccgcctggtggccgcgctggaaagcgccgccctgccccccctg
cacggctcgctccagttcgaggccgttactgggagcactgggagcactgggagcctcccc
ggggagaccgggagcggggggaggggcagg

DBGET integrated database retrieval system