KEGG   Ficedula albicollis (collared flycatcher): 101815371Help
Entry
101815371         CDS       T02815                                 

Definition
(RefSeq) trypsin I-P1-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Neuroactive ligand-receptor interaction
Influenza A
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101815371
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101815371
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101815371
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101815371
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101815371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 249 aa AA seqDB search
MKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCAKNAVPYQVSLNSGYHFCGGSLISSQW
VLSAAHCYKSRIQVQLGKHNLELTESTQQFINSAKVIRHSGYSPYTLDNDIMLIKLSTPA
QLNNAVQTIPLPTSCAAAGTTCLISGWGNTLSSGSNYPDQLQCLKAPILSAADCSDAYPG
QITSNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQRGYPGVYTKVCNYVS
WIRSTMAAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtctgctgcttctcgccttcattggggtggctgttgccttccccacctttgct
gaagatgatgatgacaagattgtgggaggctacacctgtgcaaagaacgctgtgccctat
caggtgtccctgaattctggatatcacttctgtggaggctccctcatcagcagccagtgg
gtcctgtcggctgctcactgctacaaatctcgcatccaagtgcagctcgggaaacacaac
ctggaactcaccgaatccacccagcagtttatcaactctgctaaagtcatccgccactct
ggctacagcccctacaccctggacaatgacatcatgctcatcaagctgtccaccccagcc
cagctcaacaatgctgtccaaaccatccctctgcccaccagctgcgcggccgccggcacc
acctgcctgatctccggctggggcaacactctcagcagtggctctaactacccagaccag
ctgcagtgcctgaaggctccaatcctctctgccgccgactgctctgatgcctaccctggg
caaattaccagcaacatgatctgtgtgggattcctggagggaggcaaagactcctgccag
ggagattccggcggtcccgtcgtctgcaatggacagctccagggcattgtttcctggggt
attggatgtgcccagaggggctatcccggagtttacaccaaggtttgcaactacgtctcc
tggatccggtccaccatggccgccaactga

DBGET integrated database retrieval system