KEGG   Ficedula albicollis (collared flycatcher): 101816901Help
Entry
101816901         CDS       T02815                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101816901 (GPD2)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101816901 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 EF-hand_8 EF-hand_5 EF-hand_9 HI0933_like NAD_binding_8 Thi4 Pyr_redox_3 Pyr_redox FAD_binding_3 EF-hand_10 Gly_acyl_tr_N
Motif
Other DBs
NCBI-GeneID: 101816901
NCBI-ProteinID: XP_005049803
UniProt: U3JK58
LinkDB All DBs
Position
7
AA seq 725 aa AA seqDB search
MAFQKAVKGTALIGGGAIATVFGLSQFSQYRNKHGALVQVQAAEGAPVRKEHLPSREQQL
QALQSSGEFDVLVIGGGATGCGCALDAATRGLKTALLERDDFSSGTSSRSTKLIHGGVRY
LQKAIMKLDLEQYRMVKEALEERAHLLKSAPHLSAPLPIMLPIYKWWQLPYYWVGIKLYD
LVAGSQCLRSSYVLTKARALELFPMLRRDRLVGAIVYYDGQHNDARMNLAIALTAARYGA
ATANYTEVRQLLKAAGPGGRQRVCGVRCRDVLTGKEFDVRAKCVINATGPFTDSVRRMDD
EQVPDICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTIAGTTDSPTDVT
SHPIPTEEDINFILSEVRNYLGPDVEVRRGDVLAAWSGIRPLVTNPDSKDTQSISRNHVV
TVSDSGLVTIAGGKWTTYRAMARDTIDAAIREHGLQAGSCQTMGLQLEGAEDWSPTLYIR
LVQDYGLESEVAQHLASTYGDKAFEVAKIAQVTGKRWPIVGKRLVSEFPYIEAEVVYGVK
EYARTAVDVISRRTRLAFLNVQAAEEALPRIVDIMAKELNWCDQKKKEQLEAARTFLYYE
MGYKVKTDQLTDSSEISLLPADIERYKKRFHMFDKDKKGFITILDVQRVLQSISVQMDEN
TLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAVLMKSAEENLRRRQAIPVDR
SGGGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcagaaggcagtgaaaggaactgctctcattggaggaggtgccatagcaaca
gtttttggcctctctcaattttctcagtatagaaacaaacacggtgccttggtgcaggtg
caggctgcagaaggtgctccagtgaggaaggagcatctccccagcagggagcagcagctg
caggccctgcagagcagcggggagttcgatgtgctggtcattggtgggggagccacgggc
tgtggctgtgccctggatgcagccaccagaggactaaaaacagcccttctggaaagagat
gatttctcatcagggaccagcagcaggagcactaaattgatccatggtggggtgaggtac
ctccagaaggccatcatgaagctggatttggagcagtacaggatggtgaaggaggctctg
gaggagcgagcacacctgctgaagagtgcaccccacctctcagccccgctgcccatcatg
ctgcccatctacaagtggtggcagctgccctactactgggttggcatcaagctgtacgac
ctggtggccggcagccagtgcctgaggagcagctacgtgctgaccaaggcccgggccctg
gagctgttccccatgctgcgcagggacaggctggtgggagccattgtctactacgatggc
cagcacaacgacgcgcgcatgaacctggccatcgcgctgaccgccgcacgctacggcgcc
gccaccgccaactacaccgaggtgcggcagctgctgaaggcagcggggccgggcgggaga
cagcgcgtctgcggcgtgcgctgccgggacgtgctcaccgggaaggagttcgatgtcagg
gccaagtgcgtgatcaacgccacgggcccgttcaccgactcggtgcgcaggatggacgac
gagcaggtgcccgacatctgccagcccagcgcgggcgtgcacatcgtcatgcctggctac
tacagccctgacaacatggggctgctggacccggccaccagcgatggcagagtgatcttc
ttcctgccctgggagaagatgacgatcgcagggaccacggacagccccacagacgtcacc
tcccaccccatccccaccgaggaggacatcaacttcatcctgagcgaagtgcgcaactac
ctggggccagacgtggaagtgagaagaggagatgtgctggcagcctggagtggcatccgg
cccctggtcaccaaccccgactccaaggacacgcagtccatctcccggaaccacgtggtg
accgtcagcgacagcggcctcgtcaccatcgcaggtgggaagtggaccacgtaccgtgcc
atggccagggacaccatcgacgcggccatcagggagcacggcctgcaggcaggctcctgc
cagaccatggggctgcagctggagggggctgaggactggagccccacgctctacatcagg
ctggtccaggactatgggctggagagtgaggtggctcagcacctggcttccacctacggg
gacaaggcttttgaggtggccaaaatagcccaggtgacagggaagaggtggcctattgtt
gggaaacgtctggtgtctgaatttccttacattgaagctgaggtggtgtacggggtgaag
gagtacgcgcgcaccgccgtggacgtcatctcccgccgcacgcgcctggccttcctcaac
gtgcaggctgccgaggaggcgctgcccaggatcgtggacatcatggccaaggagctcaac
tggtgcgaccagaagaagaaggagcagcttgaagctgctagaacatttctgtactacgag
atgggctacaaagtgaaaacagaccaattaacagacagctctgagatcagcctgctgcct
gcagacatcgagaggtacaagaagcgcttccacatgttcgacaaggacaagaagggtttc
atcaccatcctggacgtgcagcgtgtgctgcagagcatcagcgtgcagatggacgagaac
accctgcacgagatcctcaacgaggtggatctcaacaagaacgggcaggtggagctcaac
gagttcctgcagctgatgagtgccatccagaagggccgtgtgtcgggcagcaggctggcc
gtgctgatgaagagcgccgaggagaacctgcggcggcgccaggccatccccgtggaccgc
agcgggggcgggctctga

DBGET integrated database retrieval system