KEGG   Ficedula albicollis (collared flycatcher): 101818309Help
Entry
101818309         CDS       T02815                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  
beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101818309 (B3GALT1)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     101818309 (B3GALT1)
Glycosyltransferases [BR:fab01003]
 Glycan extension
  Type 1 chain
   101818309 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
7
AA seq 326 aa AA seqDB search
MASKVSCLYILTVVCWASALWYLSITRPTSSYTGHRQVSSISIARKNVSFGNIRTRPINP
HSFDFLINEPNKCEKSAPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPNTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQITPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcgtgtttatacattttgacagtagtttgttgggcaagcgctctt
tggtacctaagtataactcgtcctacttcttcctacacgggccacagacaggtcagcagc
atatccatagccagaaaaaatgtttcctttggcaacataagaactcgacctataaatcca
cattcctttgactttcttatcaatgaacccaacaaatgtgagaagagtgccccatttctg
gtcattcttatcagtacaactcacaaagagtttgatgcaaggcaagccattcgagaaacg
tggggagatgaaaacaatttcaaaggaattaaaatcgccacactctttcttcttggaaaa
aatgcagatcctgtgttaaatcaaatggtagagcaagaaagccaaatttttcacgacatt
attgtggaagattttatcgactcttaccacaacctcactctgaaaacgttgatgggaatg
aggtgggtagcaacattttgttcaaaagcaaagtatgttatgaagacagacagtgatatt
tttgtaaatatggacaatcttatttataagctgctcaaacctaacaccaagccaaggaga
aggtacttcacaggttatgttataaatggaggaccaataagagatgttcgcagtaagtgg
tacatgcccagagatttgtatcccgacagcaattacccacccttctgttcaggcactggc
tacattttttcagctgatgtagcagaactgatttacaaaacctcccttcataccagactt
cttcatctagaagatgtgtacgttggactctgccttcggaagctgggcattcaccccttc
caaaacagtggcttcaatcactggaaaatggcctacagcttgtgcaggtaccgcagggtg
atcacagtgcaccagataacaccagaagaaatgcacagaatttggaatgacatgtccagc
aagaaacatcttagatgttaa

DBGET integrated database retrieval system