KEGG   Frankia alni: FRAAL3453Help
Entry
FRAAL3453         CDS       T00384                                 

Definition
(GenBank) Putative peptide synthetase
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
3742003..3743847
Genome map
AA seq 614 aa AA seqDB search
MTGGPAAGTRTDHDVAGALLPDVLRRRAAGDPDGRAFILLDEHGDERAALTYRELYTRAL
AIADRLGRRCGPGERALLVFPQGLEFIVAYFGCLYARVIAVPVNPPRRGAVQDATRAIVR
DCAPTAVLSTGPMIDVVRVPLEAVTGPLAWIAVDETVPEPTLEPTDAAPDWSGEPDTVAF
LQYTSGSTADPKGVMVTHRNLAANQEMIRLAFGHDRHSTFVGWAPLFHDQGLIGNVLQPL
YLGATGVLLDPGAFIRRPLLWLAAISRYRAHTSGGPNFAFDVCAAAAAGGGVPDLDLSCW
RVAFNGAEPIRADTLRRFADAFAPVGFDPRALYPCYGLAEATLLVTGSRKGRGPRTLDAD
ADGLGAGRYTPTPPGRGRPLVGSGLAPAAFDGATAQAEGAMALGPWVAAEVRIVDPETGR
GAPPDRIGEIWVAGDHVAAGYWQRPAATADTFQARCADAPGRSYLRTGDLGLIVDGELYV
VGRHKDMLVLRGRNHYPQDLEQTAAAAHPALRPGGCAAFAVPGPGGERPVVVQEVRGEPG
TDADPADVAGSIRAAVVRQHDLTLADLVLVRPGTLPKTSSGKIMRAAARRRYLAGDLAPW
AASPPAAPASSPAG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcgggcctgcggcggggacgcgaaccgatcacgacgtggcgggcgccctgctg
ccggacgtgctgcgccgacgcgccgccggcgacccggacgggcgggcgttcatcctgctc
gacgagcacggcgacgagcgggccgcgctgacctaccgggagctgtacacccgggcgctg
gccatcgccgaccggctgggccgccgctgcgggccgggggagcgggcgctgctggtcttc
ccgcagggcctggagttcatcgttgcctacttcggctgcctgtacgcccgcgtcatcgcc
gtgccggtcaacccgccgcgccgcggcgcggtccaggacgccacccgcgcgatcgtgcgg
gactgcgcgcccaccgccgtcctgtccaccggcccgatgatcgacgtggtccgggtgccg
ctggaggccgtcaccggcccgctggcgtggatcgcggtggacgagaccgtccccgagccg
accctggagccgaccgacgctgcgccggactggtcgggcgagccggacacggtcgcgttc
cttcagtacacctccgggtccacggccgacccgaagggcgtgatggtcacccatcgcaac
ctggcggcgaaccaggagatgatccggctcgccttcggccacgaccggcactcgacgttc
gtcggctgggcgccgctgttccacgaccagggcctcatcggcaacgtgctgcaaccgctg
tacctcggcgcgaccggcgtgctgctggacccgggggcgttcatccgccgcccactgctg
tggctcgcggcgatctcccgctaccgcgcccacaccagcggcggtccgaacttcgccttc
gacgtctgcgcggccgcggcggccggcggcggcgtgcccgacctggacctgagctgctgg
cgggtcgcgttcaacggcgccgaaccgatccgcgccgacacgctgcgccgcttcgccgac
gccttcgccccggtcggattcgacccgcgcgcgctctacccctgctacggcctggccgag
gcgacgctgctggtcaccggcagccgcaagggccgcggcccccgcaccctcgacgcggac
gccgacgggctcggcgcgggccgttacaccccgaccccacccggccgcggccggcccctc
gtcggctccggccttgcccccgccgccttcgatggcgccacggcgcaggccgagggcgcc
atggcgctcgggccgtgggtcgcagccgaggtgcggatcgtcgatccggagaccgggcgc
ggcgctccgcccgaccggatcggggagatctgggtcgccggcgaccacgtggcggccggc
tactggcagcgcccggcggccaccgccgacacctttcaggcccgctgcgccgacgcgccc
ggccgctcctatctgcgcaccggcgacctcggcctgatcgtcgacggcgagctgtacgtc
gtgggtcggcacaaggacatgctggtcctgcgcggccgcaaccactacccgcaggacctc
gaacagaccgccgcggcggcgcaccccgcgctgcggcccggcgggtgcgccgccttcgcg
gtcccgggcccgggcggggaacgccccgtcgtcgtccaggaggtgcgcggcgaacccggc
acggacgccgaccccgcggacgtcgccgggtcgatccgcgccgcggtggtgcgccaacac
gacctcacgctggcggacctggtgctcgtccgcccgggcacactgcccaagaccagcagc
ggcaagatcatgcgagccgccgcccgccgccgctacctggctggcgacctcgcaccgtgg
gcggcttcgccccctgccgcgccggcgtcgtccccggccggctga

DBGET integrated database retrieval system