KEGG   Fictibacillus arsenicus: ABE41_018950Help
Entry
ABE41_018950      CDS       T04452                                 

Definition
(GenBank) bacillolysin
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
far  Fictibacillus arsenicus
Brite
Enzymes [BR:far01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     ABE41_018950
Peptidases [BR:far01002]
 Metallo Peptidases
  Family M4: thermolysin family
   ABE41_018950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3752525..3754198)
Genome map
AA seq 557 aa AA seqDB search
MNTKRFAALGLALGLAVSPLAGGQASADSPVNVLSTKQFNSFMGTPSFVSGKLSEATSKS
AKDVVLTYIQKESQTFKLGSQKAGEAFSVKSVTKDELGRQMVRLQQTYKGVPVWGSTQVA
HVNDKGELLVFSGTVVPNLQDKPGLGFGKKITASKAVEAAVADLGFTPEYEADPTSDLVV
YTQGDEAAYAYLVNLNFLSPEPGNYNYFVDAKTGKILNSYNDLDEANGGHKAPPGGGGGT
LVGTDAVGSGTGVLGDTKSLNTLLSNGTYYLQDNTRGNGVFTYDAKNRQQLPGSLWADAD
NQFNASYDRAAVDAHVYAGATYDYYKEVFNRNSYDNNGAALKSSVHYGRNYNNAFWNGQQ
MVYGDGDGTTFVSLSGGLDVVAHELTHAVTDFSSDLIYQNESGALNEAMSDIFGTLVEHH
ENNNPDYEIGEDIYTPGTNGDALRSMSDPTKYNDPDHYSVRYTGTGDNGGVHINSGIINK
AAYLLAIGGTHYGVTVPAIGNDKVGAIYYRANTVYLTASSNFSQARAALVQAAADLYGAT
SAEVNAVKKSYDAVGVN
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaagagatttgcagcattgggtttagcattggggttggcagtaagtccgtta
gcaggaggacaagcatcagcagattcaccggttaacgttttatcgacaaagcaatttaac
agttttatgggtacaccatcattcgtatcaggtaaattgtctgaggctacaagcaaatcc
gctaaagatgtggttcttacatatattcaaaaagaatcccagactttcaaactcggaagc
caaaaagcgggtgaagctttctcagtaaaatcagtaacgaaagatgagcttgggcgccaa
atggtccgccttcagcaaacatataaaggagtaccggtttggggctccacacaagtcgct
catgtgaacgataaaggagagcttcttgtattctctggaacagtggttccgaatctgcag
gacaagcctggactagggtttgggaaaaagattacagcttccaaagcagttgaagcagca
gttgcagatctaggtttcacacctgaatatgaagcagatccaacttcagatttggtggtt
tacacacaaggggacgaagcagcttatgcttatctcgtaaacctgaacttcttatctcct
gaaccaggcaactacaactattttgtagatgcaaaaacaggaaagattctcaattcttac
aatgatttagatgaagcgaacggcggtcacaaagcacctcctggaggcggaggaggtaca
ttagttggaacagatgctgtcggctctggaactggtgtccttggtgacacgaagtcgctg
aacacgttattatcaaacggaacgtactacctgcaagataacacaagaggaaacggtgta
ttcacgtacgatgcaaagaatcgccagcagctgccgggcagcctttgggcggatgcggat
aaccagttcaatgcttcatatgatcgggcagctgtagatgctcacgtttatgcaggtgcg
acttacgattattataaagaagtatttaaccgtaactcgtatgacaataatggggctgcg
cttaaatcttctgtccactacggtcgcaactacaacaacgcattctggaacggtcagcag
atggtatacggagatggtgatggaacaacattcgtttcactttccggcggtctggatgtt
gtagctcatgaattaacacatgctgttacagacttctcatctgatttgatctatcaaaat
gagtcaggtgctctaaacgaagcgatgtctgatatcttcggaacgcttgtagagcatcac
gaaaacaataacccggattacgagattggtgaagacatctacacgccaggaacgaatggt
gacgcgcttcgttccatgagtgatccgacgaaatacaatgatcctgaccactattctgtt
cgctacacaggaacaggagataacggcggtgtacacatcaacagtggaatcatcaataaa
gcagcttacttgctggcaattggcggaacgcattatggtgtgacagttcctgcgatcgga
aacgataaagttggagcgatctactacagagctaacacggtttacttaacggcttcttct
aacttcagccaagcgagagcggctctagttcaagcggcagctgatctgtatggtgcaaca
tcagctgaagtgaatgctgtgaaaaaatcttatgacgcagtcggtgtaaactaa

DBGET integrated database retrieval system