KEGG   Flavobacteriaceae bacterium 3519-10: FIC_00592Help
Entry
FIC_00592         CDS       T00953                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FIC_00592
  Energy metabolism
   00680 Methane metabolism
    FIC_00592
Enzymes [BR:fba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FIC_00592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
611686..614226
Genome map
AA seq 846 aa AA seqDB search
MQNQEKTEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESKAGYENGKNPVEI
VEEFFSKHTGLESEGQKTELLFKIIQYIERQVVLFDSIEDAAFAELHPAGETGTLLQLYD
RSLQQHQLEATRAKMKDFAVRVVFTAHPTQFYPSSVQRILHDLRSAIMKDSVTEIDMLLQ
QLGKTPFLNREKPTPLDEAMSIIFYLRYVYYDSLGELYAKIKNSFGDGDFVPPHDIFQLG
FWPGGDRDGNPFVTAETTLQVAKELNSSVLKSYYEHLKKLRRRLSFRGVSEVLDMLSDAL
YDAIFKDQHITSDEILNRIHEAQQILNGKHNGLFGDLLDDFEDRVKIFGTHFATLDIRQD
SRVHQNVIDEIVMKKSDLQSENIMNEDKLKWLLETDVILNPEDFEGITQDTLRNICNIKD
IQKINGARGMSRYIISNSDGIKDVLNVFGLFRLCGYKEDDINIDIVPLFETMEGLDAGEG
VMRELYELPVYRKHLERRGNAQTIMLGFSDGTKDGGYLKANWEIYETKEQLTKVSDENNI
KVIFFDGRGGPPARGGGKTHDFYASQGKTIANNKIEITIQGQTITSVFGNKDQAKYNFEQ
LLTAGIENDVFKNSKKDLTENERNLIRELAEISFKKYSDLKAHPMFVPYLQEMSTLQYYG
KTNIGSRPSKRAGNDELKFEDLRAIPFVGSWSQLKQNVPGFFGFGFALHQLKMQGRFDEI
RALYKGSDFFKTLVLNSMMSMNKSYFPLTYYMKNNLRFGGFWSILFEEYELSKALMLELT
GFKMLMEEEPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGNREAYEKLVMRSLFGNIN
ASRNSA
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccaggaaaagaccgagaaattcaggcaaatcgtcgaaaacaagtttcagatt
tacaattcactgttcatgagtttgccttatgataaaatgaccaacatcggcatgctgctg
ccttttctgtacgaagaaagcaaagccggttacgaaaacggcaaaaaccccgtagaaatt
gtagaggagtttttcagtaaacacaccggcctcgaatctgaagggcaaaaaaccgaactg
ctgttcaaaatcatccagtacatcgagcggcaggtcgtgcttttcgacagtattgaagac
gctgctttcgccgaactgcatcctgccggcgaaacaggaaccctgcttcagctatacgac
cgctcgctgcagcaacatcagcttgaggcgacgcgtgctaagatgaaagatttcgcggta
agagttgtctttacggcgcacccaacgcaattttacccgagttctgtacagagaatcctg
cacgatttgcgttcggccatcatgaaagattcggttactgaaatcgatatgcttttgcag
cagctcggcaaaactccttttctaaaccgtgaaaaacctacgccgctcgacgaagccatg
agcatcattttttacctgcgctatgtgtattatgattctttgggcgaactgtacgcgaag
attaaaaattcatttggagacggtgattttgttccacctcacgatattttccagcttggt
ttctggcctggcggcgaccgggacggaaatccgtttgttactgctgaaacaaccctgcag
gtggcgaaggaactgaactcctcagtcctcaaatcctattacgaacaccttaaaaagcta
agacggcgcttaagtttcagaggtgtttcggaagtactcgatatgcttagtgatgcgctt
tatgacgcaatcttcaaagatcagcacattacttccgatgaaattttaaacagaatacac
gaagcccagcagattcttaacgggaagcataacggcctcttcggcgatcttttggatgat
tttgaagaccgtgtgaagattttcggaactcatttcgctactttggatatccgccaggac
agccgagtgcatcagaatgtcatcgatgaaattgtgatgaagaagtccgatttgcaatcc
gaaaatattatgaatgaggataaactaaaatggcttcttgaaaccgatgtaatcttaaat
cctgaggattttgagggcataacgcaggacacgctcagaaatatctgtaatattaaagac
atccagaaaataaacggcgcgcgcggcatgagccggtatatcatctcgaattccgacggg
attaaagatgttttgaacgttttcggacttttcaggctctgcggttataaggaggatgat
atcaatatcgatattgtgccgcttttcgaaacgatggaaggtttggatgccggcgaaggt
gtgatgagggagctttatgaacttccggtttacaggaagcatctcgaaaggcgcggaaat
gcgcagaccattatgctcggcttttcagacggcaccaaagacggcggttatcttaaagcc
aactgggaaatttatgaaaccaaagagcaactcactaaagtttctgatgaaaacaatatt
aaagtaatcttcttcgacgggcgtggtggtccgcctgcgagaggcggtggaaagacgcat
gatttctatgcctcacagggaaaaaccatcgcgaacaataaaattgaaattactattcag
ggccagaccattacaagtgttttcggaaacaaggaccaagcgaagtataattttgagcaa
cttttaacggccggaattgaaaacgacgtttttaaaaattcaaaaaaagatttaacagaa
aacgaaagaaatcttatccgggaactcgctgaaataagctttaaaaaatattcagatctg
aaggcgcatccgatgttcgtgccgtacctgcaggaaatgagcacacttcaatattacggc
aaaaccaatatcggcagccggccgagcaaaagagccggaaacgatgagctgaagttcgaa
gatctgcgcgccattccttttgttggatcgtggagccagctgaagcagaatgttccggga
tttttcgggttcggctttgcgctgcatcaactgaagatgcaaggtagatttgatgaaata
agagcgctgtataaaggatctgatttctttaaaacgcttgtgttgaactcgatgatgagc
atgaataaatcttactttccgctgacctactacatgaagaataatctcaggtttggtggt
ttctggagtattctatttgaagaatacgagctttcgaaagcgctgatgctcgaacttacg
ggttttaagatgctgatggaggaagagccgctttcaagaaaatcggtaaagatccgcgag
aaaattgtgctgccgcttttaagtattcagcaatatgcgctgatgaaaattcagaaagga
gagggcaaccgcgaggcctatgaaaaacttgtgatgcgatcgctgttcggaaatattaat
gcgagcaggaactcggcgtaa

DBGET integrated database retrieval system