KEGG   Maribacter sp. HTCC2170: FB2170_03925Help
Entry
FB2170_03925      CDS       T01306                                 

Definition
(GenBank) secreted sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00511  Other glycan degradation
fbc00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    FB2170_03925
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FB2170_03925
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     FB2170_03925
Bacterial toxins [BR:fbc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   FB2170_03925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10 Mo-co_dimer
Motif
Other DBs
NCBI-ProteinID: EAR02402
UniProt: A4AN30
LinkDB All DBs
Position
complement(1141027..1142163)
Genome map
AA seq 378 aa AA seqDB search
MANRIAVLIVLFVFSSCAAQKETYHIPKGVSQIHDLFNASSNDSIACYRIPAIVTAPNGD
LVATIDERVPSCGDLKWSKDINIVMRRSEDNGKTWSKIETIVDFPFGKSASDPSMIVDRV
TKEIFLFYNYMNLDTEKDIYYLHVMKSTDNGKTWSEPKDITAQIVKPEWHKDFKFITSGR
GIQTSTGKLLHCMVNLDSGMHLFGSDDHGETWYFIDNPVSPANESKVVELVDGSWMVNAR
SNDKKGVRYVHTSSDEGKTWVTKAEHQLTDPGCNASIVRYTSIKNGHDKNRLLFSNANSD
KGRTNMTVRVSYDEGKTWSEGKTVYEGPSAYSSLTILENGDIGLLFEKDKHKENLFVSFS
LKWLTNKKDKYQKPKKKN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatagaattgcagtattgattgtcctctttgtattctcttcgtgtgctgcccaa
aaagagacttatcacattccgaaaggagtaagtcaaattcatgatctgttcaatgcaagt
tctaatgacagtatagcatgttaccgtataccagcaattgtcacagcacccaatggagat
cttgttgccaccatagatgaaagagtgccctcttgcggagatttaaaatggagtaaggac
atcaacatagtaatgcgacgaagtgaggataatggaaagacatggtcgaagattgagact
atagtggattttccttttggcaaatctgcctctgatccatcaatgatcgttgatagggtg
accaaagaaatctttctgttttataattatatgaatttggatacagaaaaggacatttat
tatctacatgtaatgaagagtacagataatggtaaaacttggagcgagcccaaagatata
acagctcaaatagtcaaacccgaatggcataaggattttaagttcattacttctggcagg
ggaattcaaacaagtacggggaaacttctacattgtatggtgaatttggatagtggaatg
catttatttggcagtgatgatcatggggaaacttggtatttcattgacaatccagtatca
ccagccaatgagtcaaaagtagtagagctggtcgacggttcttggatggtgaatgcaagg
tctaatgataaaaaaggggtgcggtatgtacatacatcttctgatgaagggaaaacatgg
gtcaccaaggcagagcatcaattgacagatccaggttgtaatgctagtattgtgcgatac
acgtcaataaaaaatggacacgataagaaccgattgctattttcgaacgccaattcagat
aaaggacgcacaaatatgacggtacgagtgagctatgacgaaggcaaaacatggtctgaa
ggcaaaactgtgtatgaaggaccttcggcctattcatcattaacaattttagaaaatggt
gatattggcttattatttgaaaaagacaagcacaaagaaaatttattcgtcagcttttcc
ttaaaatggcttaccaataaaaaagacaagtatcaaaagcctaagaaaaagaactag

DBGET integrated database retrieval system