KEGG   Maribacter sp. HTCC2170: FB2170_06580Help
Entry
FB2170_06580      CDS       T01306                                 

Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:fbc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fbc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fbc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fbc00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fbc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
1759332..1760774
Genome map
AA seq 480 aa AA seqDB search
MPNIKKTKIVATLGPATSKKEVIIDMIKAGVDVFRINFSHADYEDVTARVKMIREVNEEI
DSNIAILGDLQGPKLRVGVMSGEVVVTPGDEIDFVTGEPFEGNSERVYMNYAAFPKDVNP
GERILLDDGKLMFEVVSTNKKDKVRAKVIQGGPLKSKKGVNLPNTNISLPALTEKDVKDA
KFAISLDVDWIALSFVRHSQDIIDLQNIIKEHAEHKIPIIAKIEKPEAVENIDKIVSYCD
GLMVARGDLGVEVPAHEVPLIQKKLVLRAKKARIPVIIATQMMETMITSLTPTRAEVNDV
ANSVMDGADAVMLSGETSVGNYPVQVIEKMASILESVENSDLITVPQEPPHIRTNRYITK
SVCYHAATMANEIKAKAISTLTNSGYTAFQISAWRPSAHILVFTSNKRILTQLNLLWGVK
AFYYDKYVSTDETIEDVNGIACKKGFLDVGDMLISLAAMPIKDKGMVNTLRVTEIETCTF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatataaagaagacgaaaatagttgcaaccttaggtcctgctacaagcaaaaag
gaagtgattattgatatgataaaggctggtgttgatgtctttagaattaatttttcacat
gctgattatgaagatgttaccgcacgtgtaaaaatgattcgtgaggttaatgaagaaata
gattccaatatcgcaattttaggagatttacaagggcctaaactaagagtaggtgttatg
tcgggtgaggtggttgttactcccggtgatgaaatagattttgttactggcgaacctttt
gaaggcaattctgaacgggtttatatgaactatgcagctttcccaaaagatgtaaatcca
ggagagcgaatattattggatgatggtaagttgatgttcgaggtagtttcaaccaataaa
aaagataaagtaagggcaaaggtaattcaaggtggtccacttaaatccaaaaagggggtt
aatttgcccaatacgaacatttctttaccagcacttacagagaaagatgttaaagatgca
aaatttgctatatcattagatgtagattggattgcactttcctttgtaaggcatagtcag
gatataatcgaccttcaaaatattattaaagagcacgccgaacacaagattcctattatt
gcgaaaatcgagaaacccgaagctgtagagaatatagataagattgtttcttattgtgac
ggactaatggttgctcgtggagatctaggagttgaggttcctgcccatgaagtgcccttg
attcagaaaaaattagtgctgagggcaaaaaaagctagaattccggtaattatcgctacg
caaatgatggagactatgattaccagtcttacaccaactcgtgctgaggtaaacgatgtt
gccaattctgtaatggatggtgctgatgctgttatgctttccggggaaacctctgttgga
aattaccctgttcaggtaattgaaaaaatggccagtattcttgaaagtgtagagaattca
gatctgataaccgttccacaggagccaccacatattagaaccaacagatacattacaaag
tctgtgtgttatcatgcggcaactatggcaaatgaaatcaaggccaaagcaatatcaact
ttgaccaatagtggttatacagcttttcagatatcggcttggagaccaagtgctcatatt
ttggtatttacatccaacaaaagaattttgacccaattgaatttactttggggtgtaaag
gccttttattacgacaagtacgtttctacagacgaaactattgaagatgtaaatgggata
gcctgtaaaaaaggatttttggatgtcggagatatgcttatcagccttgcggccatgcct
atcaaggacaaaggtatggtaaacacacttagggttaccgagatagaaacctgtaccttt
taa

DBGET integrated database retrieval system