KEGG   Maribacter sp. HTCC2170: FB2170_06580Help
Entry
FB2170_06580      CDS       T01306                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00010  Glycolysis / Gluconeogenesis
fbc00230  Purine metabolism
fbc00620  Pyruvate metabolism
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01120  Microbial metabolism in diverse environments
fbc01130  Biosynthesis of antibiotics
fbc01200  Carbon metabolism
fbc01230  Biosynthesis of amino acids
Module
fbc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fbc_M00002  Glycolysis, core module involving three-carbon compounds
fbc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
fbc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_06580
   00620 Pyruvate metabolism
    FB2170_06580
  Nucleotide metabolism
   00230 Purine metabolism
    FB2170_06580
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     FB2170_06580
Membrane trafficking [BR:fbc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    FB2170_06580
Exosome [BR:fbc04147]
 Exosomal proteins
  Proteins found in most exosomes
   FB2170_06580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI PcrB IMPDH Radical_SAM
Motif
Other DBs
NCBI-ProteinID: EAR02933
UniProt: A4APL1
LinkDB All DBs
Position
1759332..1760774
Genome map
AA seq 480 aa AA seqDB search
MPNIKKTKIVATLGPATSKKEVIIDMIKAGVDVFRINFSHADYEDVTARVKMIREVNEEI
DSNIAILGDLQGPKLRVGVMSGEVVVTPGDEIDFVTGEPFEGNSERVYMNYAAFPKDVNP
GERILLDDGKLMFEVVSTNKKDKVRAKVIQGGPLKSKKGVNLPNTNISLPALTEKDVKDA
KFAISLDVDWIALSFVRHSQDIIDLQNIIKEHAEHKIPIIAKIEKPEAVENIDKIVSYCD
GLMVARGDLGVEVPAHEVPLIQKKLVLRAKKARIPVIIATQMMETMITSLTPTRAEVNDV
ANSVMDGADAVMLSGETSVGNYPVQVIEKMASILESVENSDLITVPQEPPHIRTNRYITK
SVCYHAATMANEIKAKAISTLTNSGYTAFQISAWRPSAHILVFTSNKRILTQLNLLWGVK
AFYYDKYVSTDETIEDVNGIACKKGFLDVGDMLISLAAMPIKDKGMVNTLRVTEIETCTF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatataaagaagacgaaaatagttgcaaccttaggtcctgctacaagcaaaaag
gaagtgattattgatatgataaaggctggtgttgatgtctttagaattaatttttcacat
gctgattatgaagatgttaccgcacgtgtaaaaatgattcgtgaggttaatgaagaaata
gattccaatatcgcaattttaggagatttacaagggcctaaactaagagtaggtgttatg
tcgggtgaggtggttgttactcccggtgatgaaatagattttgttactggcgaacctttt
gaaggcaattctgaacgggtttatatgaactatgcagctttcccaaaagatgtaaatcca
ggagagcgaatattattggatgatggtaagttgatgttcgaggtagtttcaaccaataaa
aaagataaagtaagggcaaaggtaattcaaggtggtccacttaaatccaaaaagggggtt
aatttgcccaatacgaacatttctttaccagcacttacagagaaagatgttaaagatgca
aaatttgctatatcattagatgtagattggattgcactttcctttgtaaggcatagtcag
gatataatcgaccttcaaaatattattaaagagcacgccgaacacaagattcctattatt
gcgaaaatcgagaaacccgaagctgtagagaatatagataagattgtttcttattgtgac
ggactaatggttgctcgtggagatctaggagttgaggttcctgcccatgaagtgcccttg
attcagaaaaaattagtgctgagggcaaaaaaagctagaattccggtaattatcgctacg
caaatgatggagactatgattaccagtcttacaccaactcgtgctgaggtaaacgatgtt
gccaattctgtaatggatggtgctgatgctgttatgctttccggggaaacctctgttgga
aattaccctgttcaggtaattgaaaaaatggccagtattcttgaaagtgtagagaattca
gatctgataaccgttccacaggagccaccacatattagaaccaacagatacattacaaag
tctgtgtgttatcatgcggcaactatggcaaatgaaatcaaggccaaagcaatatcaact
ttgaccaatagtggttatacagcttttcagatatcggcttggagaccaagtgctcatatt
ttggtatttacatccaacaaaagaattttgacccaattgaatttactttggggtgtaaag
gccttttattacgacaagtacgtttctacagacgaaactattgaagatgtaaatgggata
gcctgtaaaaaaggatttttggatgtcggagatatgcttatcagccttgcggccatgcct
atcaaggacaaaggtatggtaaacacacttagggttaccgagatagaaacctgtaccttt
taa

DBGET integrated database retrieval system