KEGG   Felis catus (domestic cat): 101081523Help
Entry
101081523         CDS       T02385                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101081523 (TMPRSS9)
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101081523 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
A2
AA seq 1123 aa AA seqDB search
MLAAADALVDPRATKDGAGARPGARLGSSWSPSQCVGAMEPTAGDLQLVPGTAKEVPAPY
TSCCRMALCVVVATSIIMVTLGVLMASLSTQGVDVEHTAQLQGVRYAHSLRHEASDYYRT
LTPALEWLFVSSFRETELEASCVGCTVLSYRDGNSSVFVHFRLHFLLQASQSLSLGLEEE
LLRQGLRARLQGHGIPLAAHGTIVSAQLTGSQKAPWTERDLKSGHCPGNTFSCRNGQCVT
KVNPECDDRVDCSDGSDEAHCDCGLQPGWKTAGRIVGGVEASPGEFPWQVSLRENKEHFC
GAAVIGARWLVSAAHCFNGFQDPAEWVAYAGTTHLSGAEASTVRVRVARITPHPLYNPDT
ADFDVAVLELDGPLAFGRHVQPVCLPAATHVFPPRRKCLISGWGYLKEDFLVKPETLQKA
TVELLDQGLCASLYGHSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSW
GIGCAEARRPGVYARVTRLRDWILEAITTAGRPLAPTAAPASTTASTARPTSPESPTRPT
LGLSAAPPDSVTASKPQECGARPAMEKPTRIVGGLGAVSGEVPWQVSLKEGSRHFCGATV
VGDRWLLSAAHCFNHTKVELVRAHLGTASLTGVGGNPVKMGLKRAVLHPQYNPGILDFDV
AVLELAGPLGFNKYIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNATKPDILQRASVGII
DQKACSALYNSSLTDRMLCAGFLEGKVDSCQGDSGGPLACEEAPGVFYLAGIVSWGVGCA
QARRPGVYARITRLKGWILDTMSSGLLPTARTPATRQSSGTAAAFTVPGVPASTATPSAT
SRATSQPANMTAATVSATAGGQTPLPDAPRTTVGFQPPDCGLAPVAAMTRIVGGSAAARG
EWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGAEGQLE
RVARIYKHPFYNLYTLDYDVALLELAGPVRRGRLVRPICLPEPTPRPPDGARCVITGWGS
VREGGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACR
EPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQNIQE
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggctgcggacgctctcgtagaccccagggccacgaaggacggcgcgggcgcc
cgacctggcgctcggctaggctccagttggtcgccttcccagtgtgtaggagccatggag
cccaccgctggtgacttacagcttgtgcctgggacagcaaaggaagtcccagctccctac
acctcgtgctgccgcatggccctctgcgttgttgtggccaccagcatcatcatggtcacc
ctgggagtcctcatggcctccctctccacacagggcgtcgacgtggagcacacggcacag
ctgcagggggtccgctacgcccacagcttgcggcacgaggcctcggactactaccgcacc
ctgacacccgctctggaatggctgtttgtgagcagctttcgggagaccgagttggaggcc
agctgtgtgggctgcaccgtgctaagttacagggatgggaattccagcgtcttcgtgcat
ttccggctgcacttcctgctgcaagcctcgcagtcactgagtctgggcctggaggaggag
ctgttgcggcagggactccgagcgaggctgcaggggcacggtatccccctggctgcccac
ggcaccattgtgtccgcccagctcacaggaagccagaaagcgccatggacagaaagagat
ttaaaatcaggtcactgcccagggaacaccttttcctgccgcaacggccagtgtgtgacc
aaagtgaacccggagtgtgacgacagagtggactgctctgacggatctgatgaggcccac
tgtgactgtggtctacagcccggctggaagacagccggccggatcgtgggtggcgtggaa
gcatccccgggagagttcccgtggcaagtcagccttcgagaaaacaaggaacacttctgt
ggggccgctgtcatcggggccaggtggctggtgtccgcggcccactgcttcaacggattc
caagacccggcggagtgggtggcctacgcaggcacgacccacctcagtggcgcagaggcc
agcacggtgcgggtgcgcgtggcccgcatcaccccgcaccccctgtacaacccggacacg
gccgacttcgacgtggcggtgctggagctggacggcccgctggccttcggcaggcacgtc
cagcccgtgtgcctgcctgccgccacgcacgtcttcccgccgcgaaggaagtgcctcatc
tccggctggggctacctcaaggaggacttcctggtcaagccagaaacgctgcagaaagcc
acagtggagctgctggaccagggcctgtgtgccagcctgtacggccactcgctcaccgac
aggatgctgtgtgccggctacctggacgggaaggtggattcctgccagggcgactcggga
ggccccctagtctgcgaggagccctctggcaggttcttcctggccggcatcgtgagctgg
ggaataggttgtgcggaagcccgacgccccggcgtctatgcccgagtgaccaggctgcgt
gactggatcctggaggccatcaccacggcgggccggcctctggcccccacggcggctccc
gcctccaccaccgccagcactgcccggcccaccagtcctgagagccccaccaggcccact
ctgggcctcagcgccgcgcctcccgactcagtcaccgcctctaagccacaagagtgtggg
gccaggcccgccatggagaagcccactcggatcgtgggcgggctgggagccgtgtccggg
gaagtgccctggcaggtcagcctgaaggaaggttcccggcacttctgtggcgccaccgtg
gtgggggaccgctggctgctgtcggccgcccactgcttcaaccacacgaaggtggagctg
gtgcgggcccacctgggcaccgcgtccctcacgggcgtcggcggaaacccagtgaagatg
gggctcaagcgggcggtgctccacccccagtacaaccccggcatcctggacttcgatgtg
gccgtgctggagttggccgggcccctgggcttcaacaagtacatccagcctgtctgcctg
cccctggctatccagaagttccccgtgggccggaagtgcatgatctccggctggggtaac
acacaggagggaaacgccactaagcctgacattctgcagagagcgtctgtgggcatcata
gaccagaaggcgtgcagcgcactctacaactcctccctcacagacaggatgctctgcgcc
ggcttcctggagggcaaagtggactcctgccagggcgactccgggggacccctggcctgc
gaggaggcccccggtgtgttttacctggcggggattgtgagctggggggtcggctgcgct
caggcccggagacctggcgtgtacgctcgaatcaccaggctgaagggctggatcctggac
accatgtcctccggcctcctccccaccgcgaggacccccgccaccaggcagtcctctggg
acggcagctgccttcacagtcccgggagtcccggccagcacagccaccccctcggccacc
agcagggcaaccagccagcccgccaacatgactgcggccaccgtaagcgccactgctggg
ggacagacacccctcccagatgccccgaggaccaccgtgggcttccagccaccagactgt
ggcctggcaccggtggcggcgatgaccaggatcgtgggtggcagcgccgcggcccgcggg
gagtggccgtggcaggtgagcctgtggctgcggcgccgggagcaccgctgcggggccgtc
ctggtggccgagaggtggctgctgtcggcggcgcactgcttcgatgtctacggggacccc
aagcagtgggcggccttcctgggcacgccgttcctgagtggcgccgaggggcagctggag
cgggtggcgcgcatctacaaacaccccttctacaacctctacacgctcgactacgacgtg
gcgctgctcgagctggcggggcccgtgcgccgcggccgcctggtgcggcccatctgcctg
ccggagcccacgccgcggccccccgacggcgcgcgctgcgtcatcaccggctggggctcg
gtgcgcgagggaggctcgatggcgcggcagctgcagaaggcggccgtgcgcctcctcagc
gagcagacgtgccgccgcttctacccggtgcagatcagcagtcgcatgctgtgcgccggc
ttcccgcagggcggcgtggacagctgttcgggcgacgccgggggacccctggcctgcagg
gagccctctggccggtgggtgctaactggggtcaccagctgggggtacggctgcgggcgg
ccccacttcccaggggtctatactcgggtggctgccgtcagaggctggatcgggcagaac
atccaggagtga

DBGET integrated database retrieval system