KEGG   Felis catus (domestic cat): 101082066Help
Entry
101082066         CDS       T02385                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101082066 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
B3
AA seq 820 aa AA seqDB search
MMDGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRNETDADW
GPEPHGDRGSGRGRGSSSGGRRPDSRGSDSRRPGSRASGVNAAGDGTIREGMLVVTGVDL
LSSRSDQNRREHHTDEFEYDELILRRGQPFDMVLHLSRPYESSDHVALELLIGNSPEVGK
GTHVIIPVGKGGSGGWKAQVTKASGQNLDLRVHTSPNAIIGKFQFTVRTRSEAGEFLLPF
DPHNEIYILFNPWCPEDIVYVEHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGV
LDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVG
SVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYF
DENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFGGWQVVDATPQETSSGIFCCGPCSV
ESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAIGSNMR
DDVTHIYKHPEGSEAERKAVETAAAHGSKPNVYSTRDSAEDVAMQVEAQDAVMGQDLTVC
VVLTNRSSSRRTVKLHLYLSVTFYTGVTGSVFKESKKEVVLAPGASDRVSMPVAYKEYRP
HLVDQGSMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPL
PITLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLHQKFVPVRPGPRQLIASLDSPQLSQ
VHGVIQVDVAPAPGSGGFFSDAGGDSHSGETIPMASRGGA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggtcctcgttcagatgtgggccgctggggcgggaacccttggcagcccccc
accacaccttccccggagccggagccggagccggacagacgatctcgtcgaggaggccgt
tccttctgggctcgctgctgcggctgctgctcatgccgaaatgaaacagatgctgactgg
ggacctgagccccacggagaccgagggtctggcaggggtcgagggtccagctctgggggt
cgaagaccagactcccggggctcagattcccgccggcctggctcccgggccagtggtgtg
aacgcagctggagacggcaccatcagagagggcatgctggtggtgaccggtgtggatctg
ctgagttcacgctcggaccagaatcgccgagagcaccacacagatgagtttgagtacgac
gagctgattttacgccgtgggcagcctttcgacatggtcctccacctctctcggccctat
gagtcctctgatcatgttgccctggagctgcttatcggaaacagccccgaggtggggaag
ggcacgcacgtgatcatcccagtggggaaggggggcagcggaggctggaaagcccaggtg
accaaggccagtgggcagaatctggacctacgtgtccacacctcccccaacgccatcatc
ggcaagtttcaattcacggtccgcacacgttcagaggctggcgagttcctgttgcctttt
gacccccacaacgagatctacatcctcttcaatccatggtgtccagaggacatcgtgtac
gtggagcatgaggattggcgacaggagtacgtgcttaatgaatccgggagaatttactat
gggactgaagcgcagattggcgagcggacctggaactatgggcagtttgaccatggagtg
ctggatgcctgcctgtacatcctagacaggcggggcatgccatatggaggccgcggggac
ccagtcagtgtctcccgggtcatctctgccatggtgaactccttggatgacaatggggtc
ctgattggaaactggtctggtgattactcccgaggcaccaacccatcagcttgggtgggc
agcgtggagatcctactcagctacctacgcaccggctattccgtcccctatggccagtgc
tgggtcttcgccggtgtgaccacaacagtgctgcgttgcttgggcctggctacccgcact
gtcaccaatttcaactcggcacatgacacagacacgtccctcaccatggacatctacttt
gacgagaatatgaagcctctcgagcacctgaaccatgattctgtttggaacttccacgtg
tggaacgactgctggatgaagaggccagatctgccctctggctttggtgggtggcaggtg
gtggatgccacaccccaggaaaccagcagcggcatcttctgctgcggcccatgctctgtg
gagtccatcaagaatggcctggtatacatgaaatacgacacacccttcatttttgccgag
gtcaacagtgacaaagtttactggcagcgacaggatgatggcagctttaagatcgtatat
gtggaagagaaggccattggtacgctcatcataacaaaggccattggatccaacatgcga
gatgatgtcacccacatttataaacacccagaaggctcggaagcagagcggaaggcagtg
gagacagcagccgcccatggcagcaaacccaacgtgtactccacgcgtgactcagcagag
gatgtggcgatgcaggtggaggcacaggacgcggtgatggggcaggacctgaccgtctgc
gtggtgctgaccaatcgcagcagcagccgccgcaccgtgaagctgcacctctacctctcg
gtcaccttctacaccggtgtcacggggtctgtcttcaaggagagcaagaaagaagtggtg
ctggcgccaggggcctcggaccgcgtgtccatgcccgtggcctacaaggaataccggccc
cacctcgtagatcaggggtccatgctgctcaacgtctcgggccacgtcaaggagaacggg
caggtgctggccaagcagcacaccttccgtctgcgcacccctgacctttccctcaccttg
ttgggggcagccgtggttggtcaggagtgcgaagtacagattgtcttcaagaacccgctg
cctataaccctcaccaatgtcgtcttccggcttgagggctccgggctacagagacccaag
atcctcaatgtgggggacattgggggcaacgagacagtgacgctgcaccagaagtttgtg
cctgtgcgaccaggcccccgccagctcatcgccagcttggacagcccccagctctcccag
gtgcatggtgtcatccaggtggacgtggctccggcccctgggagcggaggcttcttctca
gatgctggaggcgacagtcactcaggggagaccatccctatggcatctcgaggtggagct
taa

DBGET integrated database retrieval system